| UniProt ID | COA3_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y2R0 | |
| Protein Name | Cytochrome c oxidase assembly factor 3 homolog, mitochondrial | |
| Gene Name | COA3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 106 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
| Protein Description | Core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for efficient translation of MT-CO1 and mitochondrial respiratory chain complex IV assembly.. | |
| Protein Sequence | MASSGAGDPLDSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVLPRRRTRNIVTGLGIGALVLAIYGYTFYSISQERFLDELEDEAKAARARALARASGS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASSGAGDP ------CCCCCCCCC | 22814378 | ||
| 3 | Phosphorylation | -----MASSGAGDPL -----CCCCCCCCCC | 30108239 | ||
| 4 | Phosphorylation | ----MASSGAGDPLD ----CCCCCCCCCCC | 30108239 | ||
| 12 | Phosphorylation | GAGDPLDSKRGEAPF CCCCCCCCCCCCCCH | 21406692 | ||
| 14 | Methylation | GDPLDSKRGEAPFAQ CCCCCCCCCCCCHHH | - | ||
| 26 | Phosphorylation | FAQRIDPTREKLTPE HHHCCCCCCCCCCHH | 20068231 | ||
| 31 | Phosphorylation | DPTREKLTPEQLHSM CCCCCCCCHHHHHHH | 20068231 | ||
| 37 | Phosphorylation | LTPEQLHSMRQAELA CCHHHHHHHHHHHHH | 20068231 | ||
| 38 | Sulfoxidation | TPEQLHSMRQAELAQ CHHHHHHHHHHHHHH | 21406390 | ||
| 48 | Methylation | AELAQWQKVLPRRRT HHHHHHHHHCCCCCC | - | ||
| 48 | Ubiquitination | AELAQWQKVLPRRRT HHHHHHHHHCCCCCC | 21890473 | ||
| 72 | Phosphorylation | GALVLAIYGYTFYSI HHHHHHHHHHHHHHH | - | ||
| 93 | Ubiquitination | DELEDEAKAARARAL HHHHHHHHHHHHHHH | - | ||
| 93 | 2-Hydroxyisobutyrylation | DELEDEAKAARARAL HHHHHHHHHHHHHHH | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COA3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COA3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COA3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| COX1_HUMAN | COX1 | physical | 23362268 | |
| COX2_HUMAN | COX2 | physical | 23362268 | |
| COX3_HUMAN | COX3 | physical | 23362268 | |
| COX41_HUMAN | COX4I1 | physical | 23362268 | |
| COX42_HUMAN | COX4I2 | physical | 23362268 | |
| COX5A_HUMAN | COX5A | physical | 23362268 | |
| NDUA9_HUMAN | NDUFA9 | physical | 23362268 | |
| NDUV1_HUMAN | NDUFV1 | physical | 23362268 | |
| EFTU_HUMAN | TUFM | physical | 23362268 | |
| SLIRP_HUMAN | SLIRP | physical | 23362268 | |
| LPPRC_HUMAN | LRPPRC | physical | 23362268 | |
| COX1_HUMAN | COX1 | physical | 25959673 | |
| COX41_HUMAN | COX4I1 | physical | 25959673 | |
| COX2_HUMAN | COX2 | physical | 25959673 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
