UniProt ID | DIC_HUMAN | |
---|---|---|
UniProt AC | Q9UBX3 | |
Protein Name | Mitochondrial dicarboxylate carrier | |
Gene Name | SLC25A10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 287 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane.. | |
Protein Sequence | MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
54 | Phosphorylation | MALRVVRTDGILALY CCEEEEECCCHHHHH | 27.28 | 20068231 | |
61 | Phosphorylation | TDGILALYSGLSASL CCCHHHHHCCCCHHH | 8.62 | 20068231 | |
62 | Phosphorylation | DGILALYSGLSASLC CCHHHHHCCCCHHHH | 33.82 | 20068231 | |
65 | Phosphorylation | LALYSGLSASLCRQM HHHHCCCCHHHHHHH | 21.24 | 20068231 | |
67 | Phosphorylation | LYSGLSASLCRQMTY HHCCCCHHHHHHHHH | 25.32 | 20068231 | |
82 | Phosphorylation | SLTRFAIYETVRDRV HHHHHHHHHHHHHHH | 11.34 | 25839225 | |
93 | Phosphorylation | RDRVAKGSQGPLPFH HHHHHCCCCCCCCCC | 31.12 | 28509920 | |
118 | Phosphorylation | LAGGFVGTPADLVNV CCCCCCCCHHHHCEE | 15.25 | - | |
132 | Acetylation | VRMQNDVKLPQGQRR EECCCCCCCCCHHCC | 58.26 | 27452117 | |
253 | Phosphorylation | KLGPLAFYKGLVPAG CCCCCHHHCCCCCCC | 9.87 | 28331001 | |
254 | Ubiquitination | LGPLAFYKGLVPAGI CCCCHHHCCCCCCCC | 39.04 | 21890473 | |
254 | Succinylation | LGPLAFYKGLVPAGI CCCCHHHCCCCCCCC | 39.04 | 23954790 | |
254 | Ubiquitination | LGPLAFYKGLVPAGI CCCCHHHCCCCCCCC | 39.04 | - | |
254 (in isoform 1) | Ubiquitination | - | 39.04 | 21890473 | |
263 (in isoform 2) | Ubiquitination | - | 7.25 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DIC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DIC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DIC_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00139 | Succinic acid |
loading...