| UniProt ID | KRA59_HUMAN | |
|---|---|---|
| UniProt AC | P26371 | |
| Protein Name | Keratin-associated protein 5-9 | |
| Gene Name | KRTAP5-9 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 169 | |
| Subcellular Localization | ||
| Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
| Protein Sequence | MGCCGCSGGCGSSCGGCDSSCGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKRGCGSCGGSKGGCGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSGRGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQSRCCVPVCYQCKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Phosphorylation | CSGGCGSSCGGCDSS CCCCCCCCCCCCCCC | 11.32 | - | |
| 64 | Phosphorylation | CGKRGCGSCGGSKGG CCCCCCCCCCCCCCC | 17.42 | - | |
| 68 | Phosphorylation | GCGSCGGSKGGCGSC CCCCCCCCCCCCCCC | 17.26 | - | |
| 69 | Ubiquitination | CGSCGGSKGGCGSCG CCCCCCCCCCCCCCC | 63.70 | 23503661 | |
| 74 | Phosphorylation | GSKGGCGSCGCSQCS CCCCCCCCCCCCCCC | 16.06 | 30576142 | |
| 113 | Ubiquitination | CSQCSCCKPCCSSSG CCCCCCCCCCCCCCC | 45.47 | 23503661 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRA59_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRA59_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRA59_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
