| UniProt ID | RAMP3_HUMAN | |
|---|---|---|
| UniProt AC | O60896 | |
| Protein Name | Receptor activity-modifying protein 3 | |
| Gene Name | RAMP3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 148 | |
| Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Membrane Single-pass type I membrane protein . Moves from intracellular puncta to the plasma membrane in a RAMP3-dependent manner. |
|
| Protein Description | Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.. | |
| Protein Sequence | METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 | N-linked_Glycosylation | CPRAGGCNETGMLER CCCCCCCCCCCHHHH | 53.81 | UniProtKB CARBOHYD | |
| 29 | N-linked_Glycosylation | CPRAGGCNETGMLER CCCCCCCCCCCHHHH | 53.81 | 12939163 | |
| 58 | N-linked_Glycosylation | VDVWKWCNLSEFIVY CCHHHHCCHHHHHHH | 45.55 | UniProtKB CARBOHYD | |
| 58 | N-linked_Glycosylation | VDVWKWCNLSEFIVY CCHHHHCCHHHHHHH | 45.55 | 12939163 | |
| 71 | N-linked_Glycosylation | VYYESFTNCTEMEAN HHHHHHCCCCCEEEC | 28.80 | UniProtKB CARBOHYD | |
| 103 | N-linked_Glycosylation | IHRQFFSNCTVDRVH HHHHHHCCCEEEEEE | 21.96 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAMP3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAMP3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAMP3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NSF_HUMAN | NSF | physical | 15613468 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
