UniProt ID | RAMP3_HUMAN | |
---|---|---|
UniProt AC | O60896 | |
Protein Name | Receptor activity-modifying protein 3 | |
Gene Name | RAMP3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 148 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . Membrane Single-pass type I membrane protein . Moves from intracellular puncta to the plasma membrane in a RAMP3-dependent manner. |
|
Protein Description | Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.. | |
Protein Sequence | METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 | N-linked_Glycosylation | CPRAGGCNETGMLER CCCCCCCCCCCHHHH | 53.81 | UniProtKB CARBOHYD | |
29 | N-linked_Glycosylation | CPRAGGCNETGMLER CCCCCCCCCCCHHHH | 53.81 | 12939163 | |
58 | N-linked_Glycosylation | VDVWKWCNLSEFIVY CCHHHHCCHHHHHHH | 45.55 | UniProtKB CARBOHYD | |
58 | N-linked_Glycosylation | VDVWKWCNLSEFIVY CCHHHHCCHHHHHHH | 45.55 | 12939163 | |
71 | N-linked_Glycosylation | VYYESFTNCTEMEAN HHHHHHCCCCCEEEC | 28.80 | UniProtKB CARBOHYD | |
103 | N-linked_Glycosylation | IHRQFFSNCTVDRVH HHHHHHCCCEEEEEE | 21.96 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAMP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAMP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAMP3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NSF_HUMAN | NSF | physical | 15613468 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...