UniProt ID | TB10C_HUMAN | |
---|---|---|
UniProt AC | Q8IV04 | |
Protein Name | Carabin | |
Gene Name | TBC1D10C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 446 | |
Subcellular Localization | ||
Protein Description | Inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. Acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.. | |
Protein Sequence | MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPGYYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEGARVLFRVGLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQLAQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLLTRARGPPIEGPPRPQRGSTSFLDTRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Phosphorylation | PPELQDDSSSLGSDS CCCCCCCCCCCCCCC | 30.07 | 30108239 | |
20 | Phosphorylation | PELQDDSSSLGSDSE CCCCCCCCCCCCCCH | 36.25 | 30108239 | |
21 | Phosphorylation | ELQDDSSSLGSDSEL CCCCCCCCCCCCCHH | 40.47 | 30108239 | |
24 | Phosphorylation | DDSSSLGSDSELSGP CCCCCCCCCCHHCCC | 43.17 | 30108239 | |
26 | Phosphorylation | SSSLGSDSELSGPGP CCCCCCCCHHCCCCC | 41.98 | 30108239 | |
29 | Phosphorylation | LGSDSELSGPGPYRQ CCCCCHHCCCCCCCC | 38.60 | 30108239 | |
40 | Phosphorylation | PYRQADRYGFIGGSS CCCCCCCCCCCCCCC | 19.55 | 27642862 | |
46 | Phosphorylation | RYGFIGGSSAEPGPG CCCCCCCCCCCCCCC | 22.59 | 29978859 | |
47 | Phosphorylation | YGFIGGSSAEPGPGH CCCCCCCCCCCCCCC | 39.67 | 29978859 | |
66 | Ubiquitination | LIRQREMKWVEMTSH HHHHHHCCHHHHCHH | 43.25 | - | |
71 | Phosphorylation | EMKWVEMTSHWEKTM HCCHHHHCHHHHHHH | 12.16 | 30631047 | |
72 | Phosphorylation | MKWVEMTSHWEKTMS CCHHHHCHHHHHHHH | 25.87 | 30631047 | |
76 | Ubiquitination | EMTSHWEKTMSRRYK HHCHHHHHHHHHHHH | 44.32 | - | |
77 | Phosphorylation | MTSHWEKTMSRRYKK HCHHHHHHHHHHHHH | 14.63 | - | |
79 | Phosphorylation | SHWEKTMSRRYKKVK HHHHHHHHHHHHHHH | 20.88 | 30631047 | |
91 | Ubiquitination | KVKMQCRKGIPSALR HHHHHHHCCCCHHHH | 69.67 | 29967540 | |
268 | Phosphorylation | ARSLPFPTVLRVWDA HHCCCCCHHHHHHHH | 32.33 | - | |
347 | Ubiquitination | RDLQREIKAQLAQLP HHHHHHHHHHHHCCC | 25.90 | - | |
388 | Ubiquitination | AGVRRGAKPEVPRIV HCCCCCCCCCCCEEE | 44.53 | - | |
414 | Ubiquitination | RKPQTRGKTFHGLLT CCCCCCCCCHHHHHH | 44.73 | - | |
415 | Phosphorylation | KPQTRGKTFHGLLTR CCCCCCCCHHHHHHH | 24.56 | 26657352 | |
421 | Phosphorylation | KTFHGLLTRARGPPI CCHHHHHHHCCCCCC | 27.59 | 27251275 | |
424 | Methylation | HGLLTRARGPPIEGP HHHHHHCCCCCCCCC | 55.66 | 115387557 | |
438 | Phosphorylation | PPRPQRGSTSFLDTR CCCCCCCCCCCCCCC | 24.06 | 23401153 | |
439 | Phosphorylation | PRPQRGSTSFLDTRF CCCCCCCCCCCCCCC | 26.73 | 20058876 | |
440 | Phosphorylation | RPQRGSTSFLDTRF- CCCCCCCCCCCCCC- | 26.05 | 28450419 | |
444 | Phosphorylation | GSTSFLDTRF----- CCCCCCCCCC----- | 35.80 | 23684312 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TB10C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TB10C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TB10C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...