UniProt ID | NMU_HUMAN | |
---|---|---|
UniProt AC | P48645 | |
Protein Name | Neuromedin-U | |
Gene Name | NMU | |
Organism | Homo sapiens (Human). | |
Sequence Length | 174 | |
Subcellular Localization | Secreted. | |
Protein Description | Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder.. | |
Protein Sequence | MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
109 | O-linked_Glycosylation | KRFLFHYSKTQKLGK HHHEEEHHHHHCCCC | 22.21 | 55833227 | |
139 | Oxidation | PHLHERRMKRFRVDE HHHHHHHHHHHCCCH | 4.59 | - | |
166 | Asparagine amide | YFLFRPRNGRRSAGF EEEECCCCCCCCCCC | 51.51 | - | |
166 | Amidation | YFLFRPRNGRRSAGF EEEECCCCCCCCCCC | 51.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NMU_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NMU_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NMU_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NMUR1_HUMAN | NMUR1 | physical | 10894543 | |
NMUR2_HUMAN | NMUR2 | physical | 10894543 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...