UniProt ID | JOS1_HUMAN | |
---|---|---|
UniProt AC | Q15040 | |
Protein Name | Josephin-1 | |
Gene Name | JOSD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 202 | |
Subcellular Localization | Cell membrane . Cytoplasm . Ubiquitination increases localization the plasma membrane. In the cytosol, the unubiquitinated form may be associated with the cytoskeleton via ACTB-binding. | |
Protein Description | Deubiquitinates monoubiquitinated probes (in vitro). When ubiquitinated, cleaves 'Lys-63'-linked and 'Lys-48'-linked poly-ubiquitin chains (in vitro), hence may act as a deubiquitinating enzyme. May increase macropinocytosis and suppress clathrin- and caveolae-mediated endocytosis. May enhance membrane dynamics and cell motility independently of its catalytic activity.. | |
Protein Sequence | MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSCVPWKGD ------CCCCCCCCC | 24.66 | 26074081 | |
12 | Ubiquitination | PWKGDKAKSESLELP CCCCCHHCCCCCCCC | 61.57 | - | |
13 | Phosphorylation | WKGDKAKSESLELPQ CCCCHHCCCCCCCCC | 36.96 | 23401153 | |
15 | Phosphorylation | GDKAKSESLELPQAA CCHHCCCCCCCCCCC | 33.95 | 23927012 | |
27 | Phosphorylation | QAAPPQIYHEKQRRE CCCCCCCCCHHHHHH | 9.93 | 23403867 | |
30 | Ubiquitination | PPQIYHEKQRRELCA CCCCCCHHHHHHHHH | 35.47 | - | |
70 | Phosphorylation | LSPNTMVTPHKKSML HCCCCEECCCCHHHC | 14.62 | 28674419 | |
73 | Ubiquitination | NTMVTPHKKSMLGNG CCEECCCCHHHCCCC | 47.98 | - | |
74 | Ubiquitination | TMVTPHKKSMLGNGN CEECCCCHHHCCCCC | 37.76 | 21906983 | |
158 | Ubiquitination | YNLDSKLKMPEWIGG EECCCCCCCCHHHCC | 57.03 | 21906983 | |
174 | Ubiquitination | SELRKFLKHHLRGKN HHHHHHHHHHHCCCC | 31.92 | - | |
180 | Ubiquitination | LKHHLRGKNCELLLV HHHHHCCCCCEEEEE | 52.57 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JOS1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JOS1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JOS1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TIM8A_HUMAN | TIMM8A | physical | 19615732 | |
UBC_HUMAN | UBC | physical | 19382171 | |
UBC_HUMAN | UBC | physical | 23625928 | |
TRIM1_HUMAN | MID2 | physical | 25416956 | |
KRA92_HUMAN | KRTAP9-2 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
UBC_HUMAN | UBC | physical | 21118805 | |
SOCS1_HUMAN | SOCS1 | physical | 28355105 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...