UniProt ID | ISK2_HUMAN | |
---|---|---|
UniProt AC | P20155 | |
Protein Name | Serine protease inhibitor Kazal-type 2 | |
Gene Name | SPINK2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 84 | |
Subcellular Localization | Secreted. | |
Protein Description | Strong inhibitor of acrosin in male and/or female genital tract. Also inhibits trypsin.. | |
Protein Sequence | MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MALSVLRLALL ----CHHHHHHHHHH | 15.01 | 24719451 | |
24 | Pyrrolidone_carboxylic_acid | FAASLIPQFGLFSKY HHHHHHHHHCCCCCC | 37.74 | - | |
24 | Pyrrolidone_carboxylic_acid | FAASLIPQFGLFSKY HHHHHHHHHCCCCCC | 37.74 | 2226783 | |
24 | Pyrrolidone_carboxylic_acid | FAASLIPQFGLFSKY HHHHHHHHHCCCCCC | 37.74 | 2226783 | |
29 | Phosphorylation | IPQFGLFSKYRTPNC HHHHCCCCCCCCCCC | 33.54 | 24719451 | |
30 | Ubiquitination | PQFGLFSKYRTPNCS HHHCCCCCCCCCCCH | 31.27 | - | |
33 | Phosphorylation | GLFSKYRTPNCSQYR CCCCCCCCCCCHHCC | 18.76 | 22210691 | |
54 | Phosphorylation | HFNPVCGSDMSTYAN CCCCCCCCCHHHCCC | 25.64 | 30576142 | |
58 | Phosphorylation | VCGSDMSTYANECTL CCCCCHHHCCCCCEE | 21.73 | 22210691 | |
77 | Ubiquitination | REGGHNIKIIRNGPC CCCCCCEEEEECCCC | 37.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ISK2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ISK2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ISK2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATL4_HUMAN | ADAMTSL4 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
GFRP_HUMAN | GCHFR | physical | 28514442 | |
ATP5S_HUMAN | ATP5S | physical | 28514442 | |
NUDT8_HUMAN | NUDT8 | physical | 28514442 | |
MIPEP_HUMAN | MIPEP | physical | 28514442 | |
DCA15_HUMAN | DCAF15 | physical | 28514442 | |
CT2NL_HUMAN | CTTNBP2NL | physical | 28514442 | |
PRDC1_HUMAN | PRTFDC1 | physical | 28514442 | |
UBR2_HUMAN | UBR2 | physical | 28514442 | |
PDP2_HUMAN | PDP2 | physical | 28514442 | |
IDE_HUMAN | IDE | physical | 28514442 | |
MPPB_HUMAN | PMPCB | physical | 28514442 | |
RSPRY_HUMAN | RSPRY1 | physical | 28514442 | |
MPPA_HUMAN | PMPCA | physical | 28514442 | |
PHOCN_HUMAN | MOB4 | physical | 28514442 | |
STRP1_HUMAN | STRIP1 | physical | 28514442 | |
IKIP_HUMAN | IKBIP | physical | 28514442 | |
STRN_HUMAN | STRN | physical | 28514442 | |
UBR1_HUMAN | UBR1 | physical | 28514442 | |
STRN3_HUMAN | STRN3 | physical | 28514442 | |
STRN4_HUMAN | STRN4 | physical | 28514442 | |
VATD_HUMAN | ATP6V1D | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Pyrrolidone carboxylic acid | |
Reference | PubMed |
"Amino acid sequence elucidation of human acrosin-trypsin inhibitor(HUSI-II) reveals that Kazal-type proteinase inhibitors arestructurally related to beta-subunits of glycoprotein hormones."; Fink E., Hehlein-Fink C., Eulitz M.; FEBS Lett. 270:222-224(1990). Cited for: PROTEIN SEQUENCE OF 24-84. |