| UniProt ID | ISK2_HUMAN | |
|---|---|---|
| UniProt AC | P20155 | |
| Protein Name | Serine protease inhibitor Kazal-type 2 | |
| Gene Name | SPINK2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 84 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Strong inhibitor of acrosin in male and/or female genital tract. Also inhibits trypsin.. | |
| Protein Sequence | MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MALSVLRLALL ----CHHHHHHHHHH | 15.01 | 24719451 | |
| 24 | Pyrrolidone_carboxylic_acid | FAASLIPQFGLFSKY HHHHHHHHHCCCCCC | 37.74 | - | |
| 24 | Pyrrolidone_carboxylic_acid | FAASLIPQFGLFSKY HHHHHHHHHCCCCCC | 37.74 | 2226783 | |
| 24 | Pyrrolidone_carboxylic_acid | FAASLIPQFGLFSKY HHHHHHHHHCCCCCC | 37.74 | 2226783 | |
| 29 | Phosphorylation | IPQFGLFSKYRTPNC HHHHCCCCCCCCCCC | 33.54 | 24719451 | |
| 30 | Ubiquitination | PQFGLFSKYRTPNCS HHHCCCCCCCCCCCH | 31.27 | - | |
| 33 | Phosphorylation | GLFSKYRTPNCSQYR CCCCCCCCCCCHHCC | 18.76 | 22210691 | |
| 54 | Phosphorylation | HFNPVCGSDMSTYAN CCCCCCCCCHHHCCC | 25.64 | 30576142 | |
| 58 | Phosphorylation | VCGSDMSTYANECTL CCCCCHHHCCCCCEE | 21.73 | 22210691 | |
| 77 | Ubiquitination | REGGHNIKIIRNGPC CCCCCCEEEEECCCC | 37.08 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ISK2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ISK2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ISK2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATL4_HUMAN | ADAMTSL4 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
| GFRP_HUMAN | GCHFR | physical | 28514442 | |
| ATP5S_HUMAN | ATP5S | physical | 28514442 | |
| NUDT8_HUMAN | NUDT8 | physical | 28514442 | |
| MIPEP_HUMAN | MIPEP | physical | 28514442 | |
| DCA15_HUMAN | DCAF15 | physical | 28514442 | |
| CT2NL_HUMAN | CTTNBP2NL | physical | 28514442 | |
| PRDC1_HUMAN | PRTFDC1 | physical | 28514442 | |
| UBR2_HUMAN | UBR2 | physical | 28514442 | |
| PDP2_HUMAN | PDP2 | physical | 28514442 | |
| IDE_HUMAN | IDE | physical | 28514442 | |
| MPPB_HUMAN | PMPCB | physical | 28514442 | |
| RSPRY_HUMAN | RSPRY1 | physical | 28514442 | |
| MPPA_HUMAN | PMPCA | physical | 28514442 | |
| PHOCN_HUMAN | MOB4 | physical | 28514442 | |
| STRP1_HUMAN | STRIP1 | physical | 28514442 | |
| IKIP_HUMAN | IKBIP | physical | 28514442 | |
| STRN_HUMAN | STRN | physical | 28514442 | |
| UBR1_HUMAN | UBR1 | physical | 28514442 | |
| STRN3_HUMAN | STRN3 | physical | 28514442 | |
| STRN4_HUMAN | STRN4 | physical | 28514442 | |
| VATD_HUMAN | ATP6V1D | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Pyrrolidone carboxylic acid | |
| Reference | PubMed |
| "Amino acid sequence elucidation of human acrosin-trypsin inhibitor(HUSI-II) reveals that Kazal-type proteinase inhibitors arestructurally related to beta-subunits of glycoprotein hormones."; Fink E., Hehlein-Fink C., Eulitz M.; FEBS Lett. 270:222-224(1990). Cited for: PROTEIN SEQUENCE OF 24-84. | |