UniProt ID | NUDT8_HUMAN | |
---|---|---|
UniProt AC | Q8WV74 | |
Protein Name | Nucleoside diphosphate-linked moiety X motif 8 | |
Gene Name | NUDT8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization | ||
Protein Description | Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.. | |
Protein Sequence | MLPDCLSAEGELRCRRLLAGATARLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVDEVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTAVITEFALQLLAPGTYQPRLAGLTCSGAEGLARPKQPLASPCQASSTPGLNKGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | RRLLAGATARLRARP HHHHCHHHHHHHCCC | 16.05 | 24719451 | |
40 | Phosphorylation | AVLVPLCSVRGVPAL EEHHCCCCCCCCCHH | 23.64 | - | |
50 | Phosphorylation | GVPALLYTLRSSRLT CCCHHHHHHHHCCCC | 18.70 | 24719451 | |
61 | Ubiquitination | SRLTGRHKGDVSFPG CCCCCCCCCCCCCCC | 56.28 | - | |
61 | Malonylation | SRLTGRHKGDVSFPG CCCCCCCCCCCCCCC | 56.28 | 26320211 | |
70 | Succinylation | DVSFPGGKCDPADQD CCCCCCCCCCHHHCH | 41.18 | - | |
70 | Ubiquitination | DVSFPGGKCDPADQD CCCCCCCCCCHHHCH | 41.18 | 29967540 | |
70 | Succinylation | DVSFPGGKCDPADQD CCCCCCCCCCHHHCH | 41.18 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NUDT8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NUDT8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NUDT8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NUDT8_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...