| UniProt ID | ATP5S_HUMAN | |
|---|---|---|
| UniProt AC | Q99766 | |
| Protein Name | ATP synthase subunit s, mitochondrial | |
| Gene Name | ATP5S | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 215 | |
| Subcellular Localization | Mitochondrion. Mitochondrion inner membrane. | |
| Protein Description | Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway (By similarity).. | |
| Protein Sequence | MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDVGPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHMEGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNLKYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 99 | Acetylation | LPTGPLDKYKIQAID CCCCCCHHHEEEEEE | 57.01 | 19608861 | |
| 154 | Phosphorylation | QLENLQKTILEMEII HHHHHHHHHHEEEEE | 20.17 | 19690332 | |
| 162 | Phosphorylation | ILEMEIISCGNITDK HHEEEEEECCCCCHH | 22.95 | 19690332 | |
| 167 | Phosphorylation | IISCGNITDKGIIAL EEECCCCCHHHHHHH | 35.34 | 19690332 | |
| 181 | Acetylation | LRHLRNLKYLLLSDL HHHHHCHHHHHHHCC | 37.08 | 25038526 | |
| 211 | Acetylation | ALPSLELKLQLK--- HCHHCHHHHHCC--- | 25.47 | 25038526 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATP5S_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATP5S_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATP5S_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ATP5S_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
