UniProt ID | LY6H_HUMAN | |
---|---|---|
UniProt AC | O94772 | |
Protein Name | Lymphocyte antigen 6H | |
Gene Name | LY6H | |
Organism | Homo sapiens (Human). | |
Sequence Length | 140 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
Protein Description | Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response. May play a role in the intracellular trafficking of alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Seems to inhibit alpha-7/CHRNA7 signaling in hippocampal neurons.. | |
Protein Sequence | MLPAAMKGLGLALLAVLLCSAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | N-linked_Glycosylation | QDCTLTTNSSHCTPK CCCEEECCCCCCCCC | 35.96 | UniProtKB CARBOHYD | |
68 | Phosphorylation | SSSRKDHSVNKMCAS CCCCCCCCHHHHHHH | 37.20 | 28348404 | |
88 | Phosphorylation | KRHFFSDYLMGFINS HHHHCHHHHHHHHHC | 9.44 | - | |
95 | Phosphorylation | YLMGFINSGILKVDV HHHHHHHCCCEEEEH | 23.53 | - | |
115 | GPI-anchor | DLCNGAAGAGHSPWA CCCCCCCCCCCCHHH | 31.40 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LY6H_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LY6H_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LY6H_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of LY6H_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...