| UniProt ID | MCSP_HUMAN | |
|---|---|---|
| UniProt AC | P49901 | |
| Protein Name | Sperm mitochondrial-associated cysteine-rich protein | |
| Gene Name | SMCP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 116 | |
| Subcellular Localization |
Cytoplasm. Mitochondrion membrane Peripheral membrane protein Cytoplasmic side . Becomes associated with the spermatid mitochondrion capsule at step 16 of spermatogenesis.. |
|
| Protein Description | Involved in sperm motility. Its absence is associated with genetic background dependent male infertility. Infertility may be due to reduced sperm motility in the female reproductive tract and inability to penetrate the oocyte zona pellucida (By similarity).. | |
| Protein Sequence | MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Phosphorylation | QCCQPKGSQCCPPKH CCCCCCCCCCCCCCC | 26.60 | 29396449 | |
| 91 | Phosphorylation | NMESEPNSPQTQDKG CCCCCCCCCCCCCCC | 29.15 | 22210691 | |
| 94 | Phosphorylation | SEPNSPQTQDKGCQT CCCCCCCCCCCCCCC | 41.96 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MCSP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCSP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCSP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR412_HUMAN | KRTAP4-12 | physical | 16189514 | |
| PLS1_HUMAN | PLSCR1 | physical | 16189514 | |
| ITF2_HUMAN | TCF4 | physical | 25416956 | |
| CACO2_HUMAN | CALCOCO2 | physical | 25416956 | |
| RGS17_HUMAN | RGS17 | physical | 25416956 | |
| KR412_HUMAN | KRTAP4-12 | physical | 25416956 | |
| KRA92_HUMAN | KRTAP9-2 | physical | 25416956 | |
| KRA94_HUMAN | KRTAP9-4 | physical | 25416956 | |
| LCE4A_HUMAN | LCE4A | physical | 25416956 | |
| KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
| KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
| KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
| KRA56_HUMAN | KRTAP5-6 | physical | 25416956 | |
| KR411_HUMAN | KRTAP4-11 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
