CX6A1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CX6A1_HUMAN
• UniProt AC: P12074
• Protein Name: Cytochrome c oxidase subunit 6A1, mitochondrial
• Gene Name: COX6A1
• Organism: Homo sapiens (Human).
• Sequence Length: 109
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport..
• Protein Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MAVVGVSSVSRLLG -CCCCCHHHHHHHHC	21.06	30631047
10	Phosphorylation	VVGVSSVSRLLGRSR CCCHHHHHHHHCCCC	21.11	30631047
82	Ubiquitination	PHLRIRTKPFPWGDG CCCEEECCCCCCCCC	34.51	21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CX6A1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CX6A1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CX6A1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of CX6A1_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 616039: Charcot-Marie-Tooth disease, recessive, intermediate type, D (CMTRID)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.