UniProt ID | CISD2_HUMAN | |
---|---|---|
UniProt AC | Q8N5K1 | |
Protein Name | CDGSH iron-sulfur domain-containing protein 2 | |
Gene Name | CISD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 135 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. Mitochondrion outer membrane Single-pass membrane protein. According to PubMed:20010695, it mainly localizes to the endoplasmic reticulum. However, experiments in mouse showed that it mai |
|
Protein Description | Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy.. | |
Protein Sequence | MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MVLESVARIVKV ---CCHHHHHHHHHC | 19.54 | 30001349 | |
19 | 2-Hydroxyisobutyrylation | VQLPAYLKRLPVPES CHHHHHHHCCCCCCH | 38.93 | - | |
19 | Ubiquitination | VQLPAYLKRLPVPES CHHHHHHHCCCCCCH | 38.93 | 21890473 | |
34 | Phosphorylation | ITGFARLTVSEWLRL HCCCHHCCHHHHHHH | 19.21 | 20068231 | |
36 | Phosphorylation | GFARLTVSEWLRLLP CCHHCCHHHHHHHHH | 20.16 | 20068231 | |
67 | Ubiquitination | LPKKKQQKDSLINLK CCCCHHCCCCHHCCE | 46.95 | 33845483 | |
67 | 2-Hydroxyisobutyrylation | LPKKKQQKDSLINLK CCCCHHCCCCHHCCE | 46.95 | - | |
69 | Phosphorylation | KKKQQKDSLINLKIQ CCHHCCCCHHCCEEC | 37.88 | 27499020 | |
74 | Acetylation | KDSLINLKIQKENPK CCCHHCCEECCCCCC | 38.31 | 23236377 | |
74 | Ubiquitination | KDSLINLKIQKENPK CCCHHCCEECCCCCC | 38.31 | 33845483 | |
74 | 2-Hydroxyisobutyrylation | KDSLINLKIQKENPK CCCHHCCEECCCCCC | 38.31 | - | |
74 | Malonylation | KDSLINLKIQKENPK CCCHHCCEECCCCCC | 38.31 | 26320211 | |
81 | Acetylation | KIQKENPKVVNEINI EECCCCCCCCCCCCH | 71.09 | 26051181 | |
81 | Ubiquitination | KIQKENPKVVNEINI EECCCCCCCCCCCCH | 71.09 | 33845483 | |
92 | Glutathionylation | EINIEDLCLTKAAYC CCCHHHHHHHHHHHH | 7.59 | 22555962 | |
95 | Acetylation | IEDLCLTKAAYCRCW HHHHHHHHHHHHHHH | 20.33 | 25953088 | |
95 | Ubiquitination | IEDLCLTKAAYCRCW HHHHHHHHHHHHHHH | 20.33 | 21963094 | |
104 | Phosphorylation | AYCRCWRSKTFPACD HHHHHHHCCCCCCCC | 16.14 | 23312004 | |
105 | Ubiquitination | YCRCWRSKTFPACDG HHHHHHCCCCCCCCC | 45.68 | 33845483 | |
106 | Phosphorylation | CRCWRSKTFPACDGS HHHHHCCCCCCCCCC | 35.78 | 26657352 | |
116 | Ubiquitination | ACDGSHNKHNELTGD CCCCCCCCCCCCCCC | 42.24 | 33845483 | |
131 | 2-Hydroxyisobutyrylation | NVGPLILKKKEV--- CCCCEEEEECCC--- | 55.60 | - | |
131 | Ubiquitination | NVGPLILKKKEV--- CCCCEEEEECCC--- | 55.60 | 33845483 | |
131 | Methylation | NVGPLILKKKEV--- CCCCEEEEECCC--- | 55.60 | - | |
131 | Acetylation | NVGPLILKKKEV--- CCCCEEEEECCC--- | 55.60 | 23236377 | |
132 | Ubiquitination | VGPLILKKKEV---- CCCEEEEECCC---- | 51.20 | 24816145 | |
132 | Methylation | VGPLILKKKEV---- CCCEEEEECCC---- | 51.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CISD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CISD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CISD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BCL2_HUMAN | BCL2 | physical | 20010695 | |
A4_HUMAN | APP | physical | 21832049 |
loading...