UniProt ID | KGUA_HUMAN | |
---|---|---|
UniProt AC | Q16774 | |
Protein Name | Guanylate kinase | |
Gene Name | GUK1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 197 | |
Subcellular Localization | ||
Protein Description | Essential for recycling GMP and indirectly, cGMP.. | |
Protein Sequence | MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGPRPVVL ------CCCCCCEEE | 58.46 | 27067055 | |
2 | Acetylation | ------MSGPRPVVL ------CCCCCCEEE | 58.46 | 19413330 | |
13 | Phosphorylation | PVVLSGPSGAGKSTL CEEECCCCCCCHHHH | 44.81 | 29514088 | |
17 | Ubiquitination | SGPSGAGKSTLLKRL CCCCCCCHHHHHHHH | 39.47 | - | |
18 | Phosphorylation | GPSGAGKSTLLKRLL CCCCCCHHHHHHHHH | 24.30 | 24719451 | |
19 | Phosphorylation | PSGAGKSTLLKRLLQ CCCCCHHHHHHHHHH | 39.33 | 29514088 | |
23 (in isoform 3) | Phosphorylation | - | 40.37 | 22210691 | |
23 (in isoform 2) | Phosphorylation | - | 40.37 | 22210691 | |
31 (in isoform 3) | Phosphorylation | - | 3.23 | 22210691 | |
31 (in isoform 2) | Phosphorylation | - | 3.23 | 22210691 | |
51 | Ubiquitination | RPGEENGKDYYFVTR CCCCCCCCEEEEEEH | 54.89 | 21890473 | |
53 | Phosphorylation | GEENGKDYYFVTREV CCCCCCEEEEEEHHH | 11.42 | 26356563 | |
54 | Phosphorylation | EENGKDYYFVTREVM CCCCCEEEEEEHHHH | 11.16 | 26356563 | |
72 | Ubiquitination | IAAGDFIEHAEFSGN HHCCCCHHEEEECCC | 36.72 | 21890473 | |
94 | Sulfoxidation | AVQAVQAMNRICVLD HHHHHHHHHCEEEEE | 1.61 | 21406390 | |
111 | Ubiquitination | LQGVRNIKATDLRPI CCCCCCCCCCCCCCE | 49.10 | - | |
139 | Phosphorylation | QRLRQRNTETEESLV HHHHHCCCCCHHHHH | 46.61 | 21406692 | |
141 | Phosphorylation | LRQRNTETEESLVKR HHHCCCCCHHHHHHH | 42.91 | 21406692 | |
144 | Phosphorylation | RNTETEESLVKRLAA CCCCCHHHHHHHHHH | 32.03 | 21406692 | |
147 | Ubiquitination | ETEESLVKRLAAAQA CCHHHHHHHHHHHHC | 47.16 | - | |
147 | Acetylation | ETEESLVKRLAAAQA CCHHHHHHHHHHHHC | 47.16 | 25953088 | |
158 | Phosphorylation | AAQADMESSKEPGLF HHHCHHHHCCCCCCC | 39.82 | - | |
159 | Phosphorylation | AQADMESSKEPGLFD HHCHHHHCCCCCCCE | 27.94 | - | |
173 | Phosphorylation | DVVIINDSLDQAYAE EEEEECCCHHHHHHH | 29.38 | - | |
178 | Phosphorylation | NDSLDQAYAELKEAL CCCHHHHHHHHHHHH | 8.58 | - | |
190 | Acetylation | EALSEEIKKAQRTGA HHHHHHHHHHHHHCC | 45.39 | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KGUA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KGUA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KGUA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TTC19_HUMAN | TTC19 | physical | 26186194 | |
TTC19_HUMAN | TTC19 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...