| UniProt ID | KGUA_HUMAN | |
|---|---|---|
| UniProt AC | Q16774 | |
| Protein Name | Guanylate kinase | |
| Gene Name | GUK1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 197 | |
| Subcellular Localization | ||
| Protein Description | Essential for recycling GMP and indirectly, cGMP.. | |
| Protein Sequence | MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGPRPVVL ------CCCCCCEEE | 58.46 | 27067055 | |
| 2 | Acetylation | ------MSGPRPVVL ------CCCCCCEEE | 58.46 | 19413330 | |
| 13 | Phosphorylation | PVVLSGPSGAGKSTL CEEECCCCCCCHHHH | 44.81 | 29514088 | |
| 17 | Ubiquitination | SGPSGAGKSTLLKRL CCCCCCCHHHHHHHH | 39.47 | - | |
| 18 | Phosphorylation | GPSGAGKSTLLKRLL CCCCCCHHHHHHHHH | 24.30 | 24719451 | |
| 19 | Phosphorylation | PSGAGKSTLLKRLLQ CCCCCHHHHHHHHHH | 39.33 | 29514088 | |
| 23 (in isoform 3) | Phosphorylation | - | 40.37 | 22210691 | |
| 23 (in isoform 2) | Phosphorylation | - | 40.37 | 22210691 | |
| 31 (in isoform 3) | Phosphorylation | - | 3.23 | 22210691 | |
| 31 (in isoform 2) | Phosphorylation | - | 3.23 | 22210691 | |
| 51 | Ubiquitination | RPGEENGKDYYFVTR CCCCCCCCEEEEEEH | 54.89 | 21890473 | |
| 53 | Phosphorylation | GEENGKDYYFVTREV CCCCCCEEEEEEHHH | 11.42 | 26356563 | |
| 54 | Phosphorylation | EENGKDYYFVTREVM CCCCCEEEEEEHHHH | 11.16 | 26356563 | |
| 72 | Ubiquitination | IAAGDFIEHAEFSGN HHCCCCHHEEEECCC | 36.72 | 21890473 | |
| 94 | Sulfoxidation | AVQAVQAMNRICVLD HHHHHHHHHCEEEEE | 1.61 | 21406390 | |
| 111 | Ubiquitination | LQGVRNIKATDLRPI CCCCCCCCCCCCCCE | 49.10 | - | |
| 139 | Phosphorylation | QRLRQRNTETEESLV HHHHHCCCCCHHHHH | 46.61 | 21406692 | |
| 141 | Phosphorylation | LRQRNTETEESLVKR HHHCCCCCHHHHHHH | 42.91 | 21406692 | |
| 144 | Phosphorylation | RNTETEESLVKRLAA CCCCCHHHHHHHHHH | 32.03 | 21406692 | |
| 147 | Ubiquitination | ETEESLVKRLAAAQA CCHHHHHHHHHHHHC | 47.16 | - | |
| 147 | Acetylation | ETEESLVKRLAAAQA CCHHHHHHHHHHHHC | 47.16 | 25953088 | |
| 158 | Phosphorylation | AAQADMESSKEPGLF HHHCHHHHCCCCCCC | 39.82 | - | |
| 159 | Phosphorylation | AQADMESSKEPGLFD HHCHHHHCCCCCCCE | 27.94 | - | |
| 173 | Phosphorylation | DVVIINDSLDQAYAE EEEEECCCHHHHHHH | 29.38 | - | |
| 178 | Phosphorylation | NDSLDQAYAELKEAL CCCHHHHHHHHHHHH | 8.58 | - | |
| 190 | Acetylation | EALSEEIKKAQRTGA HHHHHHHHHHHHHCC | 45.39 | 25953088 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KGUA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KGUA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KGUA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TTC19_HUMAN | TTC19 | physical | 26186194 | |
| TTC19_HUMAN | TTC19 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...