UniProt ID | AIFM2_HUMAN | |
---|---|---|
UniProt AC | Q9BRQ8 | |
Protein Name | Apoptosis-inducing factor 2 | |
Gene Name | AIFM2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 373 | |
Subcellular Localization |
Cytoplasm. Mitochondrion outer membrane. Membrane Lipid-anchor . |
|
Protein Description | Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death. Binds to DNA in a sequence-independent manner. May contribute to genotoxin-induced growth arrest.. | |
Protein Sequence | MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 (in isoform 1) | Ubiquitination | - | 50.51 | 21890473 | |
63 (in isoform 2) | Ubiquitination | - | 50.51 | 21890473 | |
153 (in isoform 2) | Ubiquitination | - | 29.35 | 21890473 | |
188 (in isoform 2) | Ubiquitination | - | 7.46 | 21890473 | |
193 (in isoform 1) | Ubiquitination | - | 37.98 | 21890473 | |
225 (in isoform 1) | Ubiquitination | - | 27.65 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIFM2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIFM2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIFM2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of AIFM2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Myristoylation | |
Reference | PubMed |
"Strategy for comprehensive identification of human N-myristoylatedproteins using an insect cell-free protein synthesis system."; Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E.,Tsunasawa S., Utsumi T.; Proteomics 10:1780-1793(2010). Cited for: MYRISTOYLATION AT GLY-2. |