| UniProt ID | RMND1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NWS8 | |
| Protein Name | Required for meiotic nuclear division protein 1 homolog | |
| Gene Name | RMND1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 449 | |
| Subcellular Localization | Mitochondrion . May be localized in mitochondrial RNA granules (PubMed:25604853). | |
| Protein Description | Required for mitochondrial translation, possibly by coordinating the assembly or maintenance of the mitochondrial ribosome. [PubMed: 23022098] | |
| Protein Sequence | MPATLLRAVARSHHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTASGLNKSQILEMNQKKSDTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQDLASHGYVEVTSLPRDAANILVMGVENSAKEGDPGTIFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAILEKFAFSNALCLSVKLAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMNEKLQHCMELTDLMRNHLNEKRALRLEWMIVILITIEVMFELGRVFF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 81 | Phosphorylation | KSDTSMLSPLNAARC CCCCCCCCHHHHHHC | 20.78 | 25849741 | |
| 108 | O-linked_Glycosylation | FGTHRRVTHKPNLLG HCCCCCCCCCCCCCC | 23.52 | 30379171 | |
| 151 | Phosphorylation | VKRPLKASRTRQPSR CCCCCCCCCCCCCCC | 32.37 | 24719451 | |
| 243 | Phosphorylation | FWNVKDKTMKHVMKV EEECCHHHHHHHHHH | 41.40 | 24719451 | |
| 249 | Acetylation | KTMKHVMKVLEKHEI HHHHHHHHHHHHCCC | 42.45 | 26822725 | |
| 281 | Ubiquitination | IKIEGQSKLHRGEIK EEEECCCCEECCCEE | 40.19 | - | |
| 281 | 2-Hydroxyisobutyrylation | IKIEGQSKLHRGEIK EEEECCCCEECCCEE | 40.19 | - | |
| 291 | Phosphorylation | RGEIKLNSELDLDDA CCCEECCCCCCCCHH | 50.39 | - | |
| 337 | Ubiquitination | QSIPEALKAGKKVKL HHHHHHHHCCCCCCC | 63.24 | - | |
| 394 | Phosphorylation | DKTCQFLSIGRRVKV CCCCCHHHHHHHHHH | 25.04 | 30257219 | |
| 405 | Ubiquitination | RVKVMNEKLQHCMEL HHHHHHHHHHHHHHH | 48.74 | - | |
| 413 | Phosphorylation | LQHCMELTDLMRNHL HHHHHHHHHHHHHHC | 17.49 | 29083192 | |
| 423 | Ubiquitination | MRNHLNEKRALRLEW HHHHCCHHHHHHHHH | 41.73 | - | |
| 423 | 2-Hydroxyisobutyrylation | MRNHLNEKRALRLEW HHHHCCHHHHHHHHH | 41.73 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RMND1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RMND1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RMND1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FAM9B_HUMAN | FAM9B | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...