UniProt ID | RMND1_HUMAN | |
---|---|---|
UniProt AC | Q9NWS8 | |
Protein Name | Required for meiotic nuclear division protein 1 homolog | |
Gene Name | RMND1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 449 | |
Subcellular Localization | Mitochondrion . May be localized in mitochondrial RNA granules (PubMed:25604853). | |
Protein Description | Required for mitochondrial translation, possibly by coordinating the assembly or maintenance of the mitochondrial ribosome. [PubMed: 23022098] | |
Protein Sequence | MPATLLRAVARSHHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTASGLNKSQILEMNQKKSDTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQDLASHGYVEVTSLPRDAANILVMGVENSAKEGDPGTIFFFREGAAVFWNVKDKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAILEKFAFSNALCLSVKLAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMNEKLQHCMELTDLMRNHLNEKRALRLEWMIVILITIEVMFELGRVFF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
81 | Phosphorylation | KSDTSMLSPLNAARC CCCCCCCCHHHHHHC | 20.78 | 25849741 | |
108 | O-linked_Glycosylation | FGTHRRVTHKPNLLG HCCCCCCCCCCCCCC | 23.52 | 30379171 | |
151 | Phosphorylation | VKRPLKASRTRQPSR CCCCCCCCCCCCCCC | 32.37 | 24719451 | |
243 | Phosphorylation | FWNVKDKTMKHVMKV EEECCHHHHHHHHHH | 41.40 | 24719451 | |
249 | Acetylation | KTMKHVMKVLEKHEI HHHHHHHHHHHHCCC | 42.45 | 26822725 | |
281 | Ubiquitination | IKIEGQSKLHRGEIK EEEECCCCEECCCEE | 40.19 | - | |
281 | 2-Hydroxyisobutyrylation | IKIEGQSKLHRGEIK EEEECCCCEECCCEE | 40.19 | - | |
291 | Phosphorylation | RGEIKLNSELDLDDA CCCEECCCCCCCCHH | 50.39 | - | |
337 | Ubiquitination | QSIPEALKAGKKVKL HHHHHHHHCCCCCCC | 63.24 | - | |
394 | Phosphorylation | DKTCQFLSIGRRVKV CCCCCHHHHHHHHHH | 25.04 | 30257219 | |
405 | Ubiquitination | RVKVMNEKLQHCMEL HHHHHHHHHHHHHHH | 48.74 | - | |
413 | Phosphorylation | LQHCMELTDLMRNHL HHHHHHHHHHHHHHC | 17.49 | 29083192 | |
423 | Ubiquitination | MRNHLNEKRALRLEW HHHHCCHHHHHHHHH | 41.73 | - | |
423 | 2-Hydroxyisobutyrylation | MRNHLNEKRALRLEW HHHHCCHHHHHHHHH | 41.73 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RMND1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RMND1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RMND1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FAM9B_HUMAN | FAM9B | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...