UniProt ID | COX7C_HUMAN | |
---|---|---|
UniProt AC | P15954 | |
Protein Name | Cytochrome c oxidase subunit 7C, mitochondrial | |
Gene Name | COX7C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 63 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
Protein Sequence | MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MLGQSIRRFTTS ---CCCHHHHHHHHH | 19.10 | 20068231 | |
17 | Phosphorylation | TTSVVRRSHYEEGPG HHHHHHHHHCCCCCC | 21.62 | 20068231 | |
25 | Acetylation | HYEEGPGKNLPFSVE HCCCCCCCCCCCCHH | 59.45 | - | |
25 | Succinylation | HYEEGPGKNLPFSVE HCCCCCCCCCCCCHH | 59.45 | - | |
25 | Ubiquitination | HYEEGPGKNLPFSVE HCCCCCCCCCCCCHH | 59.45 | 22817900 | |
25 | Succinylation | HYEEGPGKNLPFSVE HCCCCCCCCCCCCHH | 59.45 | 21890473 | |
34 | Acetylation | LPFSVENKWSLLAKM CCCCHHHHHHHHHHH | 25.34 | 25825284 | |
34 | Ubiquitination | LPFSVENKWSLLAKM CCCCHHHHHHHHHHH | 25.34 | 22817900 | |
34 | 2-Hydroxyisobutyrylation | LPFSVENKWSLLAKM CCCCHHHHHHHHHHH | 25.34 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX7C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX7C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX7C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COX7C_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB02659 | Cholic Acid |
loading...