| UniProt ID | COX11_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y6N1 | |
| Protein Name | Cytochrome c oxidase assembly protein COX11, mitochondrial | |
| Gene Name | COX11 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 276 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Intermembrane side . |
|
| Protein Description | Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.. | |
| Protein Sequence | MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Phosphorylation | WRWIHPGSPTRAAER CEEECCCCCCCHHHH | 27.78 | - | |
| 57 | Ubiquitination | LRWLGTWKRCSLRAR HHHCCCCCCCCCCCC | 43.28 | - | |
| 117 | Phosphorylation | SYAAVPLYRLYCQTT HHHHHHHHHHHHCCC | 7.78 | - | |
| 138 | Ubiquitination | VAGHASDKIENMVPV HCCCCCCCCCCCCCC | 49.80 | - | |
| 146 | Ubiquitination | IENMVPVKDRIIKIS CCCCCCCCCEEEEEE | 34.91 | - | |
| 188 | Ubiquitination | ALAFYRAKNPTDKPV HHHHHHCCCCCCCCE | 55.23 | - | |
| 193 | Ubiquitination | RAKNPTDKPVIGIST HCCCCCCCCEEEEEE | 43.60 | - | |
| 265 | Ubiquitination | SYTFFEAKEGHKLPV EEEEEECCCCCCCCC | 57.96 | - | |
| 269 | Ubiquitination | FEAKEGHKLPVPGYN EECCCCCCCCCCCCC | 66.40 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX11_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX11_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX11_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RL19_HUMAN | RPL19 | physical | 21988832 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
