UniProt ID | F162A_HUMAN | |
---|---|---|
UniProt AC | Q96A26 | |
Protein Name | Protein FAM162A | |
Gene Name | FAM162A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 154 | |
Subcellular Localization |
Membrane Single-pass membrane protein . Mitochondrion . |
|
Protein Description | Proposed to be involved in regulation of apoptosis; the exact mechanism may differ between cell types/tissues. May be involved in hypoxia-induced cell death of transformed cells implicating cytochrome C release and caspase activation (such as CASP9) and inducing mitochondrial permeability transition. May be involved in hypoxia-induced cell death of neuronal cells probably by promoting release of AIFM1 from mitochondria to cytoplasm and its translocation to the nucleus; however, the involvement of caspases has been reported conflictingly.. | |
Protein Sequence | MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWSGRFKKEDEIPETVSLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKKARLKEEAAMKAKTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MGSLSGLRLA -----CCCCHHHHHH | 20.33 | 24043423 | |
5 | Phosphorylation | ---MGSLSGLRLAAG ---CCCCHHHHHHHC | 37.16 | 24719451 | |
13 | Phosphorylation | GLRLAAGSCFRLCER HHHHHHCHHHHHHHC | 12.83 | 24719451 | |
47 | Phosphorylation | FCTKPQESPGAPSRT CCCCCCCCCCCCCCC | 24.32 | 25849741 | |
62 | Acetylation | YNRVPLHKPTDWQKK CCCCCCCCCCCHHHH | 58.24 | 25953088 | |
62 | Malonylation | YNRVPLHKPTDWQKK CCCCCCCCCCCHHHH | 58.24 | 26320211 | |
62 | Ubiquitination | YNRVPLHKPTDWQKK CCCCCCCCCCCHHHH | 58.24 | - | |
64 | Phosphorylation | RVPLHKPTDWQKKIL CCCCCCCCCHHHHEE | 55.46 | 24719451 | |
68 | 2-Hydroxyisobutyrylation | HKPTDWQKKILIWSG CCCCCHHHHEEEEEC | 37.21 | - | |
69 | 2-Hydroxyisobutyrylation | KPTDWQKKILIWSGR CCCCHHHHEEEEECC | 27.87 | - | |
74 | Phosphorylation | QKKILIWSGRFKKED HHHEEEEECCCCCCC | 17.07 | - | |
79 | Ubiquitination | IWSGRFKKEDEIPET EEECCCCCCCCCCCC | 68.62 | 21906983 | |
91 | Sulfoxidation | PETVSLEMLDAAKNK CCCEEHHHHHHHCHH | 5.07 | 28465586 | |
96 | 2-Hydroxyisobutyrylation | LEMLDAAKNKMRVKI HHHHHHHCHHHHHHH | 59.84 | - | |
96 | Ubiquitination | LEMLDAAKNKMRVKI HHHHHHHCHHHHHHH | 59.84 | 21906983 | |
98 | Ubiquitination | MLDAAKNKMRVKISY HHHHHCHHHHHHHHH | 27.63 | 983 | |
131 | Phosphorylation | KAAQRHETLTSLNLE HHHHHHHHHHHCCHH | 29.25 | 28122231 | |
133 | Phosphorylation | AQRHETLTSLNLEKK HHHHHHHHHCCHHHH | 38.29 | 28122231 | |
134 | Phosphorylation | QRHETLTSLNLEKKA HHHHHHHHCCHHHHH | 20.55 | 24719451 | |
139 | 2-Hydroxyisobutyrylation | LTSLNLEKKARLKEE HHHCCHHHHHHHHHH | 55.70 | - | |
139 | Ubiquitination | LTSLNLEKKARLKEE HHHCCHHHHHHHHHH | 55.70 | 21906983 | |
139 | Malonylation | LTSLNLEKKARLKEE HHHCCHHHHHHHHHH | 55.70 | 32601280 | |
140 | Ubiquitination | TSLNLEKKARLKEEA HHCCHHHHHHHHHHH | 29.39 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F162A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F162A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F162A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SRRT_HUMAN | SRRT | physical | 22939629 | |
TXTP_HUMAN | SLC25A1 | physical | 22939629 | |
CAVN1_HUMAN | PTRF | physical | 22939629 | |
VDAC2_HUMAN | VDAC2 | physical | 22939629 | |
RM22_HUMAN | MRPL22 | physical | 22939629 | |
RMD3_HUMAN | RMDN3 | physical | 22939629 | |
TM9S4_HUMAN | TM9SF4 | physical | 22939629 | |
SSRG_HUMAN | SSR3 | physical | 22939629 | |
HACL1_HUMAN | HACL1 | physical | 22939629 | |
IWS1_HUMAN | IWS1 | physical | 22939629 | |
HS90A_HUMAN | HSP90AA1 | physical | 16698020 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...