| UniProt ID | COX6C_HUMAN | |
|---|---|---|
| UniProt AC | P09669 | |
| Protein Name | Cytochrome c oxidase subunit 6C | |
| Gene Name | COX6C | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 75 | |
| Subcellular Localization | Mitochondrion inner membrane. | |
| Protein Description | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
| Protein Sequence | MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Ubiquitination | FRVADQRKKAYADFY HHHHHHHHHHHHHHH | 35.80 | - | |
| 47 | Ubiquitination | RVADQRKKAYADFYR HHHHHHHHHHHHHHH | 49.14 | - | |
| 47 | 2-Hydroxyisobutyrylation | RVADQRKKAYADFYR HHHHHHHHHHHHHHH | 49.14 | - | |
| 49 | Phosphorylation | ADQRKKAYADFYRNY HHHHHHHHHHHHHCH | 18.64 | 28152594 | |
| 53 | Phosphorylation | KKAYADFYRNYDVMK HHHHHHHHHCHHHHH | 9.86 | 28152594 | |
| 56 | Phosphorylation | YADFYRNYDVMKDFE HHHHHHCHHHHHHHH | 10.83 | 22817900 | |
| 60 | Acetylation | YRNYDVMKDFEEMRK HHCHHHHHHHHHHHH | 60.14 | 25825284 | |
| 60 | 2-Hydroxyisobutyrylation | YRNYDVMKDFEEMRK HHCHHHHHHHHHHHH | 60.14 | - | |
| 67 | Ubiquitination | KDFEEMRKAGIFQSV HHHHHHHHCCCCCCC | 50.05 | 21906983 | |
| 67 | 2-Hydroxyisobutyrylation | KDFEEMRKAGIFQSV HHHHHHHHCCCCCCC | 50.05 | - | |
| 73 | Phosphorylation | RKAGIFQSVK----- HHCCCCCCCC----- | 22.56 | 23312004 | |
| 75 | Ubiquitination | AGIFQSVK------- CCCCCCCC------- | 60.92 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX6C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX6C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX6C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PTN_HUMAN | PTN | physical | 16169070 | |
| ZN363_HUMAN | RCHY1 | physical | 21988832 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB02659 | Cholic Acid |
loading...
