UniProt ID | ACBD4_HUMAN | |
---|---|---|
UniProt AC | Q8NC06 | |
Protein Name | Acyl-CoA-binding domain-containing protein 4 | |
Gene Name | ACBD4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 268 | |
Subcellular Localization | ||
Protein Description | Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.. | |
Protein Sequence | MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELSSGQHLEESVIPGTAPCPPQRKRGCGAARRGPRSWTCGCWGQFEHYRRACRRCRRGCRAWRACPGPLSSLTLSVRLE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
80 | Phosphorylation | WNSLGKMSREEAMSA HHHHHCCCHHHHHHH | 39.77 | 21815630 | |
86 | Phosphorylation | MSREEAMSAYITEMK CCHHHHHHHHHHHHH | 25.60 | 23403867 | |
88 | Phosphorylation | REEAMSAYITEMKLV HHHHHHHHHHHHHHH | 10.89 | 23403867 | |
90 | Phosphorylation | EAMSAYITEMKLVAQ HHHHHHHHHHHHHHH | 19.83 | 23403867 | |
166 | Phosphorylation | PKEPAPPSPESHSPR CCCCCCCCCCCCCCC | 39.99 | 30266825 | |
166 (in isoform 2) | Phosphorylation | - | 39.99 | 27251275 | |
169 | Phosphorylation | PAPPSPESHSPRDLD CCCCCCCCCCCCCCC | 32.42 | 30266825 | |
171 | Phosphorylation | PPSPESHSPRDLDSE CCCCCCCCCCCCCCH | 30.80 | 30266825 | |
194 (in isoform 2) | Phosphorylation | - | 18.62 | 24275569 | |
209 (in isoform 2) | Phosphorylation | - | 27.31 | 26657352 | |
214 (in isoform 2) | Phosphorylation | - | 48.07 | 28102081 | |
222 (in isoform 2) | Phosphorylation | - | 19.20 | 28450419 | |
253 (in isoform 2) | Phosphorylation | - | 7.99 | 27251275 | |
300 (in isoform 3) | Phosphorylation | - | - | ||
309 (in isoform 3) | Phosphorylation | - | - | ||
337 (in isoform 3) | Phosphorylation | - | 30631047 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACBD4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACBD4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACBD4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...