dbPTM

ACBD4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ACBD4_HUMAN
UniProt AC	Q8NC06
Protein Name	Acyl-CoA-binding domain-containing protein 4
Gene Name	ACBD4
Organism	Homo sapiens (Human).
Sequence Length	268
Subcellular Localization
Protein Description	Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters..
Protein Sequence	MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELSSGQHLEESVIPGTAPCPPQRKRGCGAARRGPRSWTCGCWGQFEHYRRACRRCRRGCRAWRACPGPLSSLTLSVRLE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
80	Phosphorylation	WNSLGKMSREEAMSA HHHHHCCCHHHHHHH	39.77	21815630
86	Phosphorylation	MSREEAMSAYITEMK CCHHHHHHHHHHHHH	25.60	23403867
88	Phosphorylation	REEAMSAYITEMKLV HHHHHHHHHHHHHHH	10.89	23403867
90	Phosphorylation	EAMSAYITEMKLVAQ HHHHHHHHHHHHHHH	19.83	23403867
166	Phosphorylation	PKEPAPPSPESHSPR CCCCCCCCCCCCCCC	39.99	30266825
166 (in isoform 2)	Phosphorylation	-	39.99	27251275
169	Phosphorylation	PAPPSPESHSPRDLD CCCCCCCCCCCCCCC	32.42	30266825
171	Phosphorylation	PPSPESHSPRDLDSE CCCCCCCCCCCCCCH	30.80	30266825
194 (in isoform 2)	Phosphorylation	-	18.62	24275569
209 (in isoform 2)	Phosphorylation	-	27.31	26657352
214 (in isoform 2)	Phosphorylation	-	48.07	28102081
222 (in isoform 2)	Phosphorylation	-	19.20	28450419
253 (in isoform 2)	Phosphorylation	-	7.99	27251275
300 (in isoform 3)	Phosphorylation	-		-
309 (in isoform 3)	Phosphorylation	-		-
337 (in isoform 3)	Phosphorylation	-		30631047

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ACBD4_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ACBD4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ACBD4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
A4_HUMAN	APP	physical	21832049

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ACBD4_HUMAN

Related Literatures of Post-Translational Modification