UniProt ID | NANP_HUMAN | |
---|---|---|
UniProt AC | Q8TBE9 | |
Protein Name | N-acylneuraminate-9-phosphatase | |
Gene Name | NANP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 248 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Ubiquitination | VIKLLQSKYHYKEEA HHHHHHHHCCCHHHH | 24.08 | 29967540 | |
41 | Phosphorylation | LLQSKYHYKEEAEII HHHHHCCCHHHHHHH | 19.60 | - | |
42 | Acetylation | LQSKYHYKEEAEIIC HHHHCCCHHHHHHHE | 35.45 | 25953088 | |
51 | Ubiquitination | EAEIICDKVQVKLSK HHHHHEEEEEEEECH | 30.10 | 29967540 | |
57 | Phosphorylation | DKVQVKLSKECFHPY EEEEEEECHHHCCCC | 22.23 | 17192257 | |
58 | Ubiquitination | KVQVKLSKECFHPYN EEEEEECHHHCCCCC | 69.78 | 29967540 | |
83 | Phosphorylation | WEEAIQETKGGAANR HHHHHHHCCCCHHHH | 20.72 | - | |
84 | Ubiquitination | EEAIQETKGGAANRK HHHHHHCCCCHHHHH | 55.37 | 29967540 | |
101 | Ubiquitination | EECYFLWKSTRLQHM HHHHHHHHHHHHHCC | 44.06 | 29967540 | |
211 | Ubiquitination | KATVWINKNGIVPLK EEEEEECCCCEEECC | 47.63 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NANP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NANP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NANP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ESTD_HUMAN | ESD | physical | 26344197 | |
LDHB_HUMAN | LDHB | physical | 26344197 | |
MIF_HUMAN | MIF | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...