| UniProt ID | NEUR1_HUMAN | |
|---|---|---|
| UniProt AC | Q99519 | |
| Protein Name | Sialidase-1 | |
| Gene Name | NEU1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 415 | |
| Subcellular Localization |
Lysosome membrane Peripheral membrane protein Lumenal side. Lysosome lumen. Cell membrane. Cytoplasmic vesicle. Lysosome . Localized not only on the inner side of the lysosomal membrane and in the lysosomal lumen, but also on the plasma membrane an |
|
| Protein Description | Catalyzes the removal of sialic acid (N-acetylneuraminic acid) moities from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2-6 sialyl linkage.. | |
| Protein Sequence | MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTGERPSTA ------CCCCCCCCC | 47.99 | 24043423 | |
| 7 | Phosphorylation | -MTGERPSTALPDRR -CCCCCCCCCCCCCC | 32.31 | 24043423 | |
| 8 | Phosphorylation | MTGERPSTALPDRRW CCCCCCCCCCCCCCC | 34.59 | 24043423 | |
| 100 | Phosphorylation | FAEARKMSSSDEGAK HHHHHHCCCCHHHHH | 29.71 | - | |
| 107 | Ubiquitination | SSSDEGAKFIALRRS CCCHHHHHHEEEEEC | 48.43 | - | |
| 169 | Phosphorylation | AGCQVASTMLVWSKD HCCEEEEEEEEEECC | 12.56 | 25332170 | |
| 174 | Phosphorylation | ASTMLVWSKDDGVSW EEEEEEEECCCCCCC | 20.80 | 25332170 | |
| 183 | Phosphorylation | DDGVSWSTPRNLSLD CCCCCCCCCCCEEEE | 21.73 | 25332170 | |
| 186 | N-linked_Glycosylation | VSWSTPRNLSLDIGT CCCCCCCCEEEEECC | 34.87 | UniProtKB CARBOHYD | |
| 206 | Ubiquitination | GPGSGIQKQREPRKG CCCCCCHHCCCCCCC | 49.77 | 21906983 | |
| 233 | Phosphorylation | DGVFCLLSDDHGASW CCEEEEEECCCCCCC | 28.22 | 30576142 | |
| 239 | Phosphorylation | LSDDHGASWRYGSGV EECCCCCCCCCCCCC | 19.37 | 30576142 | |
| 242 | Phosphorylation | DHGASWRYGSGVSGI CCCCCCCCCCCCCCC | 14.91 | 16094384 | |
| 244 | Phosphorylation | GASWRYGSGVSGIPY CCCCCCCCCCCCCCC | 27.38 | 16094384 | |
| 247 | Phosphorylation | WRYGSGVSGIPYGQP CCCCCCCCCCCCCCC | 34.23 | 30174305 | |
| 251 | Phosphorylation | SGVSGIPYGQPKQEN CCCCCCCCCCCCCCC | 26.86 | 16094384 | |
| 343 | N-linked_Glycosylation | AHPEFRVNLTLRWSF CCCCEEEEEEEEEEE | 24.05 | UniProtKB CARBOHYD | |
| 345 | Phosphorylation | PEFRVNLTLRWSFSN CCEEEEEEEEEEECC | 14.74 | 24719451 | |
| 352 | N-linked_Glycosylation | TLRWSFSNGTSWRKE EEEEEECCCCCEEEE | 56.61 | 19159218 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEUR1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEUR1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEUR1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| EF1A1_HUMAN | EEF1A1 | physical | 16169070 | |
| GALNS_HUMAN | GALNS | physical | 8910459 | |
| BGAL_HUMAN | GLB1 | physical | 3102233 | |
| PPGB_HUMAN | CTSA | physical | 9501080 | |
| KCNA2_HUMAN | KCNA2 | physical | 10896669 | |
| KCNA4_HUMAN | KCNA4 | physical | 10896669 |
| Kegg Disease | |
|---|---|
| H00142 | Sialidosis; Mucolipidosis I |
| H00276 | Galactosialidosis |
| H00810 | Progressive myoclonic epilepsy (PME), including: Lafora disease (LBD); Unverricht-Lundborg disease ( |
| OMIM Disease | |
| 256550 | Sialidosis (SIALIDOSIS) |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00198 | Oseltamivir |
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-352, AND MASSSPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Quantitative phosphoproteome analysis using a dendrimer conjugationchemistry and tandem mass spectrometry."; Tao W.A., Wollscheid B., O'Brien R., Eng J.K., Li X.-J.,Bodenmiller B., Watts J.D., Hood L., Aebersold R.; Nat. Methods 2:591-598(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-242; SER-244 ANDTYR-251, AND MASS SPECTROMETRY. | |
