UniProt ID | LGAT1_HUMAN | |
---|---|---|
UniProt AC | Q92604 | |
Protein Name | Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 | |
Gene Name | LPGAT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 370 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Lysophosphatidylglycerol (LPG) specific acyltransferase that recognizes various acyl-CoAs and LPGs as substrates but demonstrates a clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. Prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor and oleoyl-CoA over lauroyl-CoA as an acyl donor.. | |
Protein Sequence | MAITLEEAPWLGWLLVKALMRFAFMVVNNLVAIPSYICYVIILQPLRVLDSKRFWYIEGIMYKWLLGMVASWGWYAGYTVMEWGEDIKAVSKDEAVMLVNHQATGDVCTLMMCLQDKGLVVAQMMWLMDHIFKYTNFGIVSLVHGDFFIRQGRSYRDQQLLLLKKHLENNYRSRDRKWIVLFPEGGFLRKRRETSQAFAKKNNLPFLTNVTLPRSGATKIILNALVAQQKNGSPAGGDAKELDSKSKGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIKDVPLETDDLTTWLYQRFVEKEDLLSHFYETGAFPPSKGHKEAVSREMTLSNLWIFLIQSFAFLSGYMWYNIIQYFYHCLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | NLVAIPSYICYVIIL CHHHCCHHHHHHHCC | 6.94 | - | |
128 | Ubiquitination | VAQMMWLMDHIFKYT HHHHHHHHHHHHHHH | 1.76 | 21890473 | |
164 | Ubiquitination | DQQLLLLKKHLENNY HHHHHHHHHHHHCCC | 37.81 | 21890473 | |
164 | Malonylation | DQQLLLLKKHLENNY HHHHHHHHHHHHCCC | 37.81 | 26320211 | |
164 | Ubiquitination | DQQLLLLKKHLENNY HHHHHHHHHHHHCCC | 37.81 | 21890473 | |
165 | Ubiquitination | QQLLLLKKHLENNYR HHHHHHHHHHHCCCC | 54.08 | 27667366 | |
197 | Ubiquitination | KRRETSQAFAKKNNL HCHHHHHHHHHHCCC | 13.21 | 21890473 | |
200 | Ubiquitination | ETSQAFAKKNNLPFL HHHHHHHHHCCCCCC | 49.97 | 33845483 | |
201 | Ubiquitination | TSQAFAKKNNLPFLT HHHHHHHHCCCCCCE | 47.87 | 27667366 | |
233 | Ubiquitination | VAQQKNGSPAGGDAK HHHHHCCCCCCCCHH | 22.44 | 27667366 | |
233 | Phosphorylation | VAQQKNGSPAGGDAK HHHHHCCCCCCCCHH | 22.44 | 30266825 | |
234 | Ubiquitination | AQQKNGSPAGGDAKE HHHHCCCCCCCCHHH | 36.00 | 27667366 | |
254 | Ubiquitination | KGLQWIIDTTIAYPK CCCCEEEECEEECCC | 28.76 | 22817900 | |
290 | Ubiquitination | HYRIFPIKDVPLETD EEEEEECCCCCCCCC | 53.57 | 21906983 | |
315 | Phosphorylation | VEKEDLLSHFYETGA CCHHHHHHHHHHCCC | 20.88 | 27251275 | |
318 | Phosphorylation | EDLLSHFYETGAFPP HHHHHHHHHCCCCCC | 13.73 | 27251275 | |
320 | Phosphorylation | LLSHFYETGAFPPSK HHHHHHHCCCCCCCC | 23.56 | 27251275 | |
323 | Ubiquitination | HFYETGAFPPSKGHK HHHHCCCCCCCCCCH | 10.93 | 22817900 | |
326 | Phosphorylation | ETGAFPPSKGHKEAV HCCCCCCCCCCHHHH | 52.05 | 27067055 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LGAT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LGAT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LGAT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSP7C_HUMAN | HSPA8 | physical | 26186194 | |
HS71L_HUMAN | HSPA1L | physical | 26186194 | |
POTEF_HUMAN | POTEF | physical | 26186194 | |
POTEF_HUMAN | POTEF | physical | 28514442 | |
ACTBL_HUMAN | ACTBL2 | physical | 28514442 | |
HSP7C_HUMAN | HSPA8 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...