| UniProt ID | BAX_HUMAN | |
|---|---|---|
| UniProt AC | Q07812 | |
| Protein Name | Apoptosis regulator BAX | |
| Gene Name | BAX | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 192 | |
| Subcellular Localization |
Isoform Alpha: Mitochondrion membrane Single-pass membrane protein. Cytoplasm . Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins a |
|
| Protein Description | Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). [PubMed: 21458670 Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.] | |
| Protein Sequence | MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDGSGEQP -------CCCCCCCC | 13.70 | 25944712 | |
| 4 | Phosphorylation | ----MDGSGEQPRGG ----CCCCCCCCCCC | 34.59 | 29514088 | |
| 9 | Methylation | DGSGEQPRGGGPTSS CCCCCCCCCCCCCCH | 56.96 | - | |
| 14 | Phosphorylation | QPRGGGPTSSEQIMK CCCCCCCCCHHHHHH | 48.43 | 21406692 | |
| 15 | Phosphorylation | PRGGGPTSSEQIMKT CCCCCCCCHHHHHHH | 34.70 | 28857561 | |
| 16 | Phosphorylation | RGGGPTSSEQIMKTG CCCCCCCHHHHHHHH | 35.68 | 21406692 | |
| 20 | Sulfoxidation | PTSSEQIMKTGALLL CCCHHHHHHHHHHHH | 2.96 | 30846556 | |
| 21 (in isoform 8) | Ubiquitination | - | 45.49 | 21890473 | |
| 21 (in isoform 5) | Ubiquitination | - | 45.49 | 21890473 | |
| 21 | Ubiquitination | TSSEQIMKTGALLLQ CCHHHHHHHHHHHHH | 45.49 | 21890473 | |
| 21 (in isoform 1) | Ubiquitination | - | 45.49 | 21890473 | |
| 21 (in isoform 2) | Ubiquitination | - | 45.49 | 21890473 | |
| 22 | Phosphorylation | SSEQIMKTGALLLQG CHHHHHHHHHHHHHH | 15.42 | 21712546 | |
| 38 (in isoform 7) | Ubiquitination | - | 8.71 | 21906983 | |
| 38 | Sulfoxidation | IQDRAGRMGGEAPEL HHHHCCCCCCCCCHH | 8.71 | 21406390 | |
| 57 (in isoform 1) | Ubiquitination | - | 49.58 | 21890473 | |
| 57 (in isoform 2) | Ubiquitination | - | 49.58 | 21890473 | |
| 57 | Ubiquitination | VPQDASTKKLSECLK CCCCCCHHHHHHHHH | 49.58 | 2190698 | |
| 57 (in isoform 8) | Ubiquitination | - | 49.58 | 21890473 | |
| 57 (in isoform 5) | Ubiquitination | - | 49.58 | 21890473 | |
| 58 | Ubiquitination | PQDASTKKLSECLKR CCCCCHHHHHHHHHH | 58.28 | - | |
| 60 | Phosphorylation | DASTKKLSECLKRIG CCCHHHHHHHHHHHH | 34.83 | 17911107 | |
| 64 | Ubiquitination | KKLSECLKRIGDELD HHHHHHHHHHHHHHH | 54.34 | - | |
| 72 | Phosphorylation | RIGDELDSNMELQRM HHHHHHHHHHHHHHH | 51.18 | 25338102 | |
| 74 | Sulfoxidation | GDELDSNMELQRMIA HHHHHHHHHHHHHHH | 6.69 | 30846556 | |
| 79 | Sulfoxidation | SNMELQRMIAAVDTD HHHHHHHHHHHHCCC | 1.25 | 21406390 | |
| 85 | Phosphorylation | RMIAAVDTDSPREVF HHHHHHCCCCHHHHH | 31.60 | 20068231 | |
| 87 | Phosphorylation | IAAVDTDSPREVFFR HHHHCCCCHHHHHHH | 28.13 | 20068231 | |
| 123 | Ubiquitination | FASKLVLKALCTKVP HHHHHHHHHHHCCHH | 31.65 | - | |
| 126 | S-palmitoylation | KLVLKALCTKVPELI HHHHHHHHCCHHHHH | 4.07 | 24525733 | |
| 135 | Phosphorylation | KVPELIRTIMGWTLD CHHHHHHHHHHHHHH | 14.34 | 19194518 | |
| 140 | Phosphorylation | IRTIMGWTLDFLRER HHHHHHHHHHHHHHH | 15.66 | 19194518 | |
| 145 (in isoform 5) | Phosphorylation | - | 27.29 | 22210691 | |
| 148 (in isoform 5) | Phosphorylation | - | 4.43 | 22210691 | |
| 163 (in isoform 2) | Ubiquitination | - | 24.37 | - | |
| 163 | Phosphorylation | GGWDGLLSYFGTPTW CCCCCHHHHHCCCCC | 24.37 | 15525785 | |
| 167 | Phosphorylation | GLLSYFGTPTWQTVT CHHHHHCCCCCCEEH | 13.98 | 16709574 | |
| 172 | Phosphorylation | FGTPTWQTVTIFVAG HCCCCCCEEHHHHHH | 15.92 | - | |
| 174 | Phosphorylation | TPTWQTVTIFVAGVL CCCCCEEHHHHHHHH | 16.46 | - | |
| 184 | Phosphorylation | VAGVLTASLTIWKKM HHHHHHHHHHHHHHC | 22.32 | 16679323 | |
| 186 | Phosphorylation | GVLTASLTIWKKMG- HHHHHHHHHHHHCC- | 23.46 | - | |
| 207 (in isoform 2) | Phosphorylation | - | 24719451 | ||
| 215 (in isoform 2) | Phosphorylation | - | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 163 | S | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
| 184 | S | Phosphorylation | Kinase | PRKCZ | Q05513 | GPS |
| 184 | S | Phosphorylation | Kinase | AKT-FAMILY | - | GPS |
| - | K | Ubiquitination | E3 ubiquitin ligase | RNF144B | Q7Z419 | PMID:22199232 |
| - | K | Ubiquitination | E3 ubiquitin ligase | PRKN | O60260 | PMID:22460798 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAX_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAX_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00020 | Colorectal cancer | |||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |