| UniProt ID | CRYAB_HUMAN | |
|---|---|---|
| UniProt AC | P02511 | |
| Protein Name | Alpha-crystallin B chain | |
| Gene Name | CRYAB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 175 | |
| Subcellular Localization | Cytoplasm . Nucleus . Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles (PubMed:19464326). Localizes at the Z-bands and the intercalated disk in cardiomyocytes (Pub | |
| Protein Description | May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.. | |
| Protein Sequence | MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDIAIHHP -------CCCEECCC | 8.31 | 838078 | |
| 19 | Phosphorylation | RPFFPFHSPSRLFDQ CCCCCCCCHHHHHHH | 25.58 | 26055452 | |
| 21 | Phosphorylation | FFPFHSPSRLFDQFF CCCCCCHHHHHHHHH | 44.63 | 21082442 | |
| 22 | Methylation | FPFHSPSRLFDQFFG CCCCCHHHHHHHHHH | 42.64 | 12060738 | |
| 43 | Phosphorylation | DLFPTSTSLSPFYLR CCCCCCCCCCCCCCC | 26.98 | 22817900 | |
| 45 | Phosphorylation | FPTSTSLSPFYLRPP CCCCCCCCCCCCCCH | 16.84 | 16928191 | |
| 50 | Methylation | SLSPFYLRPPSFLRA CCCCCCCCCHHHHCC | 29.69 | 12060738 | |
| 53 | Phosphorylation | PFYLRPPSFLRAPSW CCCCCCHHHHCCCCC | 39.33 | 22817900 | |
| 59 | Phosphorylation | PSFLRAPSWFDTGLS HHHHCCCCCCCCCCC | 39.11 | 28355574 | |
| 63 | Phosphorylation | RAPSWFDTGLSEMRL CCCCCCCCCCCHHCC | 30.46 | 29691806 | |
| 66 | Phosphorylation | SWFDTGLSEMRLEKD CCCCCCCCHHCCCCC | 30.59 | 28857561 | |
| 68 | Sulfoxidation | FDTGLSEMRLEKDRF CCCCCCHHCCCCCCE | 5.49 | 30846556 | |
| 74 | Methylation | EMRLEKDRFSVNLDV HHCCCCCCEEEEEEC | 36.49 | - | |
| 76 | Phosphorylation | RLEKDRFSVNLDVKH CCCCCCEEEEEECCC | 15.81 | 21082442 | |
| 82 | Ubiquitination | FSVNLDVKHFSPEEL EEEEEECCCCCHHHH | 38.30 | - | |
| 85 | Phosphorylation | NLDVKHFSPEELKVK EEECCCCCHHHHEEE | 30.99 | 28857561 | |
| 90 | Acetylation | HFSPEELKVKVLGDV CCCHHHHEEEEEEEE | 43.20 | 22424773 | |
| 90 | Ubiquitination | HFSPEELKVKVLGDV CCCHHHHEEEEEEEE | 43.20 | - | |
| 92 | Malonylation | SPEELKVKVLGDVIE CHHHHEEEEEEEEEE | 30.10 | 26320211 | |
| 92 | Ubiquitination | SPEELKVKVLGDVIE CHHHHEEEEEEEEEE | 30.10 | 22120592 | |
| 92 | Acetylation | SPEELKVKVLGDVIE CHHHHEEEEEEEEEE | 30.10 | 22120592 | |
| 115 | Phosphorylation | QDEHGFISREFHRKY CCCCCCCCHHHHHHH | 24.40 | 26437602 | |
| 132 | Phosphorylation | PADVDPLTITSSLSS CCCCCCCEEEECCCC | 27.83 | - | |
| 134 | Phosphorylation | DVDPLTITSSLSSDG CCCCCEEEECCCCCC | 13.66 | - | |
| 135 | Phosphorylation | VDPLTITSSLSSDGV CCCCEEEECCCCCCE | 25.98 | 28348404 | |
| 136 | Phosphorylation | DPLTITSSLSSDGVL CCCEEEECCCCCCEE | 24.50 | 28348404 | |
| 138 | Phosphorylation | LTITSSLSSDGVLTV CEEEECCCCCCEEEE | 28.47 | 28348404 | |
| 139 | Phosphorylation | TITSSLSSDGVLTVN EEEECCCCCCEEEEC | 43.61 | 28857561 | |
| 144 | Phosphorylation | LSSDGVLTVNGPRKQ CCCCCEEEECCCCCC | 14.98 | - | |
| 150 | Ubiquitination | LTVNGPRKQVSGPER EEECCCCCCCCCCCC | 59.18 | - | |
| 153 | Phosphorylation | NGPRKQVSGPERTIP CCCCCCCCCCCCEEC | 46.25 | 26437602 | |
| 158 | Phosphorylation | QVSGPERTIPITREE CCCCCCCEECCCCCC | 29.46 | 28857561 | |
| 162 | O-linked_Glycosylation | PERTIPITREEKPAV CCCEECCCCCCCCCC | 27.03 | 31492838 | |
| 162 | Phosphorylation | PERTIPITREEKPAV CCCEECCCCCCCCCC | 27.03 | 26437602 | |
| 166 | Ubiquitination | IPITREEKPAVTAAP ECCCCCCCCCCCCCC | 33.26 | 22120592 | |
| 166 | Acetylation | IPITREEKPAVTAAP ECCCCCCCCCCCCCC | 33.26 | 22120592 | |
| 170 | O-linked_Glycosylation | REEKPAVTAAPKK-- CCCCCCCCCCCCC-- | 21.14 | 31492838 | |
| 170 | Phosphorylation | REEKPAVTAAPKK-- CCCCCCCCCCCCC-- | 21.14 | 26437602 | |
| 170 | O-linked_Glycosylation | REEKPAVTAAPKK-- CCCCCCCCCCCCC-- | 21.14 | 8639509 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 59 | S | Phosphorylation | Kinase | MAPK14 | Q16539 | GPS |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRYAB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRYAB_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 608810 | Myopathy, myofibrillar, 2 (MFM2) | |||||
| 613763 | Cataract 16, multiple types (CTRCT16) | |||||
| 613869 | Myopathy, myofibrillar, fatal infantile hypertonic, alpha-B crystallin-related (MFMFIH-CRYAB) | |||||
| 615184 | Cardiomyopathy, dilated 1II (CMD1II) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Simultaneous racemization and isomerization at specific aspartic acidresidues in alpha B-crystallin from the aged human lens."; Fujii N., Ishibashi Y., Satoh K., Fujino M., Harada K.; Biochim. Biophys. Acta 1204:157-163(1994). Cited for: RACEMIZATION/ISOMERIZATION OF SPECIFIC ASP. | |
| "Acetylation of alphaA-crystallin in the human lens: effects onstructure and chaperone function."; Nagaraj R.H., Nahomi R.B., Shanthakumar S., Linetsky M.,Padmanabha S., Pasupuleti N., Wang B., Santhoshkumar P., Panda A.K.,Biswas A.; Biochim. Biophys. Acta 1822:120-129(2012). Cited for: ACETYLATION AT LYS-92 AND LYS-166. | |
| "Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-21; SER-43;SER-45; SER-53; SER-59 AND SER-76, METHYLATION AT ARG-22 AND ARG-50,ACETYLATION AT LYS-92, SUSCEPTIBILITY TO OXIDATION, AND MASSSPECTROMETRY. | |
| "In vivo carbamylation and acetylation of water-soluble human lensalphaB-crystallin lysine 92."; Lapko V.N., Smith D.L., Smith J.B.; Protein Sci. 10:1130-1136(2001). Cited for: ACETYLATION AT LYS-92. | |
| Methylation | |
| Reference | PubMed |
| "Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-21; SER-43;SER-45; SER-53; SER-59 AND SER-76, METHYLATION AT ARG-22 AND ARG-50,ACETYLATION AT LYS-92, SUSCEPTIBILITY TO OXIDATION, AND MASSSPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-19; SER-21; SER-43;SER-45; SER-53; SER-59 AND SER-76, METHYLATION AT ARG-22 AND ARG-50,ACETYLATION AT LYS-92, SUSCEPTIBILITY TO OXIDATION, AND MASSSPECTROMETRY. | |
| "Ser-59 is the major phosphorylation site in alphaB-crystallinaccumulated in the brains of patients with Alexander's disease."; Kato K., Inaguma Y., Ito H., Iida K., Iwamoto I., Kamei K., Ochi N.,Ohta H., Kishikawa M.; J. Neurochem. 76:730-736(2001). Cited for: PHOSPHORYLATION AT SER-45 AND SER-59. | |
| "Post-translational modifications of water-soluble human lenscrystallins from young adults."; Miesbauer L.R., Zhou X., Yang Z., Yang Z., Sun Y., Smith D.L.,Smith J.B.; J. Biol. Chem. 269:12494-12502(1994). Cited for: PHOSPHORYLATION AT SER-19; SER-45 AND SER-59, AND MASS SPECTROMETRY. | |