| UniProt ID | SEH1_HUMAN | |
|---|---|---|
| UniProt AC | Q96EE3 | |
| Protein Name | Nucleoporin SEH1 {ECO:0000305} | |
| Gene Name | SEH1L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 360 | |
| Subcellular Localization | Chromosome, centromere, kinetochore . Nucleus, nuclear pore complex . Lysosome membrane . | |
| Protein Description | Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore.; As a component of the GATOR subcomplex GATOR2, functions within the amino acid-sensing branch of the TORC1 signaling pathway. Indirectly activates mTORC1 and the TORC1 signaling pathway through the inhibition of the GATOR1 subcomplex. [PubMed: 23723238 It is negatively regulated by the upstream amino acid sensors SESN2 and CASTOR1] | |
| Protein Sequence | MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSPMIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MFVARSIAADHKD --CCCCCCCCCCCCH | 13.57 | 21406692 | |
| 12 | Acetylation | RSIAADHKDLIHDVS CCCCCCCCHHCCEEC | 55.57 | 26051181 | |
| 12 (in isoform 1) | Ubiquitination | - | 55.57 | - | |
| 12 | Sumoylation | RSIAADHKDLIHDVS CCCCCCCCHHCCEEC | 55.57 | 28112733 | |
| 12 | Ubiquitination | RSIAADHKDLIHDVS CCCCCCCCHHCCEEC | 55.57 | 23000965 | |
| 19 | Phosphorylation | KDLIHDVSFDFHGRR CHHCCEECEEECCCE | 25.75 | 20873877 | |
| 29 | Phosphorylation | FHGRRMATCSSDQSV ECCCEEEECCCCCCE | 11.99 | 20068231 | |
| 31 | Phosphorylation | GRRMATCSSDQSVKV CCEEEECCCCCCEEE | 32.37 | 26270265 | |
| 32 | Phosphorylation | RRMATCSSDQSVKVW CEEEECCCCCCEEEE | 41.64 | 20068231 | |
| 35 | Phosphorylation | ATCSSDQSVKVWDKS EECCCCCCEEEEECC | 28.97 | 26270265 | |
| 37 | Acetylation | CSSDQSVKVWDKSES CCCCCCEEEEECCCC | 42.74 | 26051181 | |
| 37 | Ubiquitination | CSSDQSVKVWDKSES CCCCCCEEEEECCCC | 42.74 | 29967540 | |
| 37 (in isoform 1) | Ubiquitination | - | 42.74 | - | |
| 41 | Ubiquitination | QSVKVWDKSESGDWH CCEEEEECCCCCCEE | 40.17 | 29967540 | |
| 41 (in isoform 1) | Ubiquitination | - | 40.17 | - | |
| 44 | Phosphorylation | KVWDKSESGDWHCTA EEEECCCCCCEEEEE | 49.49 | - | |
| 52 | Phosphorylation | GDWHCTASWKTHSGS CCEEEEEEEEECCCE | 15.79 | 24719451 | |
| 54 | Acetylation | WHCTASWKTHSGSVW EEEEEEEEECCCEEE | 33.59 | 26051181 | |
| 57 | Phosphorylation | TASWKTHSGSVWRVT EEEEEECCCEEEEEE | 37.69 | 24719451 | |
| 71 | Ubiquitination | TWAHPEFGQVLASCS EEECCCHHHHHHHCC | 18.28 | 22817900 | |
| 75 | Ubiquitination | PEFGQVLASCSFDRT CCHHHHHHHCCCCCH | 15.05 | 22817900 | |
| 82 | Phosphorylation | ASCSFDRTAAVWEEI HHCCCCCHHHHHHHH | 22.32 | 20068231 | |
| 83 | Ubiquitination | SCSFDRTAAVWEEIV HCCCCCHHHHHHHHH | 10.83 | 22817900 | |
| 86 | Ubiquitination | FDRTAAVWEEIVGES CCCHHHHHHHHHCCC | 7.87 | 22817900 | |
| 96 (in isoform 2) | Ubiquitination | - | 44.31 | 21890473 | |
| 96 | Ubiquitination | IVGESNDKLRGQSHW HHCCCCCHHCCCCEE | 44.31 | 22053931 | |
| 96 (in isoform 1) | Ubiquitination | - | 44.31 | 21890473 | |
| 96 | Acetylation | IVGESNDKLRGQSHW HHCCCCCHHCCCCEE | 44.31 | 26051181 | |
| 103 | Ubiquitination | KLRGQSHWVKRTTLV HHCCCCEEEEEEEEC | 11.54 | 22817900 | |
| 106 | Ubiquitination | GQSHWVKRTTLVDSR CCCEEEEEEEECCCC | 24.27 | 22817900 | |
| 107 | Phosphorylation | QSHWVKRTTLVDSRT CCEEEEEEEECCCCC | 20.82 | 20068231 | |
| 108 | Phosphorylation | SHWVKRTTLVDSRTS CEEEEEEEECCCCCC | 28.90 | 20068231 | |
| 112 | Phosphorylation | KRTTLVDSRTSVTDV EEEEECCCCCCCCCC | 29.94 | 20068231 | |
| 114 | Phosphorylation | TTLVDSRTSVTDVKF EEECCCCCCCCCCCC | 31.34 | 20068231 | |
| 115 | Phosphorylation | TLVDSRTSVTDVKFA EECCCCCCCCCCCCC | 23.16 | 20068231 | |
| 117 | Phosphorylation | VDSRTSVTDVKFAPK CCCCCCCCCCCCCCC | 34.54 | 20068231 | |
| 120 (in isoform 1) | Ubiquitination | - | 38.32 | 21890473 | |
| 120 (in isoform 2) | Ubiquitination | - | 38.32 | 21890473 | |
| 120 | Ubiquitination | RTSVTDVKFAPKHMG CCCCCCCCCCCCCCC | 38.32 | 22817900 | |
| 124 (in isoform 1) | Ubiquitination | - | 42.67 | - | |
| 124 | Ubiquitination | TDVKFAPKHMGLMLA CCCCCCCCCCCEEEE | 42.67 | 22817900 | |
| 159 | Ubiquitination | QWSLQHEISCKLSCS HHHHCEEEEEEEEEE | 5.70 | 22817900 | |
| 162 | Ubiquitination | LQHEISCKLSCSCIS HCEEEEEEEEEEEEE | 36.32 | 22817900 | |
| 179 | Phosphorylation | PSSSRAHSPMIAVGS CCCCCCCCCEEEECC | 18.38 | 29255136 | |
| 179 | Ubiquitination | PSSSRAHSPMIAVGS CCCCCCCCCEEEECC | 18.38 | 22817900 | |
| 181 | Ubiquitination | SSRAHSPMIAVGSDD CCCCCCCEEEECCCC | 3.26 | 21890473 | |
| 182 | Ubiquitination | SRAHSPMIAVGSDDS CCCCCCEEEECCCCC | 2.97 | 22817900 | |
| 186 | Phosphorylation | SPMIAVGSDDSSPNA CCEEEECCCCCCCCC | 31.48 | 30108239 | |
| 189 | Phosphorylation | IAVGSDDSSPNAMAK EEECCCCCCCCCEEE | 53.32 | 30108239 | |
| 189 | Ubiquitination | IAVGSDDSSPNAMAK EEECCCCCCCCCEEE | 53.32 | 23000965 | |
| 190 | Phosphorylation | AVGSDDSSPNAMAKV EECCCCCCCCCEEEE | 29.21 | 28112733 | |
| 195 | Ubiquitination | DSSPNAMAKVQIFEY CCCCCCEEEEEEEEE | 13.37 | 23000965 | |
| 196 (in isoform 1) | Ubiquitination | - | 22.91 | - | |
| 201 | Ubiquitination | MAKVQIFEYNENTRK EEEEEEEEECHHHHH | 49.42 | 21890473 | |
| 208 | Ubiquitination | EYNENTRKYAKAETL EECHHHHHHEEEEEE | 47.74 | 22817900 | |
| 209 | Phosphorylation | YNENTRKYAKAETLM ECHHHHHHEEEEEEE | 15.28 | - | |
| 209 | Ubiquitination | YNENTRKYAKAETLM ECHHHHHHEEEEEEE | 15.28 | 23000965 | |
| 211 (in isoform 1) | Ubiquitination | - | 43.60 | 21890473 | |
| 211 | Ubiquitination | ENTRKYAKAETLMTV HHHHHHEEEEEEEEE | 43.60 | 22817900 | |
| 211 (in isoform 2) | Ubiquitination | - | 43.60 | 21890473 | |
| 214 | Phosphorylation | RKYAKAETLMTVTDP HHHEEEEEEEEECCC | 27.04 | - | |
| 215 | Ubiquitination | KYAKAETLMTVTDPV HHEEEEEEEEECCCH | 1.72 | 23000965 | |
| 217 | Phosphorylation | AKAETLMTVTDPVHD EEEEEEEEECCCHHH | 24.30 | - | |
| 228 | Ubiquitination | PVHDIAFAPNLGRSF CHHHHEECCCCCCCE | 5.31 | 22817900 | |
| 231 | Ubiquitination | DIAFAPNLGRSFHIL HHEECCCCCCCEEEE | 6.16 | 22817900 | |
| 251 | Acetylation | DVRIFTLKPVRKELT CEEEEEECEECHHHH | 38.11 | 25953088 | |
| 251 (in isoform 1) | Ubiquitination | - | 38.11 | - | |
| 251 | Ubiquitination | DVRIFTLKPVRKELT CEEEEEECEECHHHH | 38.11 | - | |
| 255 | Ubiquitination | FTLKPVRKELTSSGG EEECEECHHHHCCCC | 58.26 | 29967540 | |
| 257 | Ubiquitination | LKPVRKELTSSGGPT ECEECHHHHCCCCCC | 6.71 | 21890473 | |
| 258 | Phosphorylation | KPVRKELTSSGGPTK CEECHHHHCCCCCCE | 23.18 | 25850435 | |
| 259 | Phosphorylation | PVRKELTSSGGPTKF EECHHHHCCCCCCEE | 39.34 | 26657352 | |
| 260 | Phosphorylation | VRKELTSSGGPTKFE ECHHHHCCCCCCEEE | 42.40 | 25849741 | |
| 264 | Phosphorylation | LTSSGGPTKFEIHIV HHCCCCCCEEEEEEE | 52.20 | 25850435 | |
| 265 | Ubiquitination | TSSGGPTKFEIHIVA HCCCCCCEEEEEEEE | 44.10 | 23000965 | |
| 271 | Ubiquitination | TKFEIHIVAQFDNHN CEEEEEEEEEECCCC | 1.80 | 23000965 | |
| 277 | Ubiquitination | IVAQFDNHNSQVWRV EEEEECCCCCEEEEE | 36.84 | 21890473 | |
| 285 | Ubiquitination | NSQVWRVSWNITGTV CCEEEEEEEEEECEE | 13.06 | 23000965 | |
| 291 | Ubiquitination | VSWNITGTVLASSGD EEEEEECEEEEECCC | 12.05 | 23000965 | |
| 306 | Methylation | DGCVRLWKANYMDNW CCEEEEEEEECCCCC | 31.20 | 44858439 | |
| 306 (in isoform 2) | Ubiquitination | - | 31.20 | 21890473 | |
| 306 (in isoform 1) | Ubiquitination | - | 31.20 | 21890473 | |
| 306 | Ubiquitination | DGCVRLWKANYMDNW CCEEEEEEEECCCCC | 31.20 | 21890473 | |
| 314 (in isoform 1) | Ubiquitination | - | 28.33 | - | |
| 314 | Acetylation | ANYMDNWKCTGILKG EECCCCCEEEEEEEC | 28.33 | 26051181 | |
| 314 | Ubiquitination | ANYMDNWKCTGILKG EECCCCCEEEEEEEC | 28.33 | 23000965 | |
| 320 | Ubiquitination | WKCTGILKGNGSPVN CEEEEEEECCCCCCC | 48.70 | 23000965 | |
| 324 | Phosphorylation | GILKGNGSPVNGSSQ EEEECCCCCCCCCCC | 29.67 | 28985074 | |
| 326 | Ubiquitination | LKGNGSPVNGSSQQG EECCCCCCCCCCCCC | 15.78 | 21890473 | |
| 334 | Ubiquitination | NGSSQQGTSNPSLGS CCCCCCCCCCCCHHH | 22.46 | 23000965 | |
| 340 | Ubiquitination | GTSNPSLGSTIPSLQ CCCCCCHHHCHHHHH | 27.38 | 23000965 | |
| 361 (in isoform 1) | Phosphorylation | - | 22673903 | ||
| 365 | Phosphorylation | KHS------------ CCC------------ | 24719451 | ||
| 365 (in isoform 1) | Phosphorylation | - | 21815630 | ||
| 367 | Methylation | S-------------- C-------------- | - | ||
| 407 (in isoform 1) | Phosphorylation | - | 23186163 | ||
| 409 | Phosphorylation | -------------------------------------------------------- -------------------------------------------------------- | 24719451 | ||
| 409 (in isoform 1) | Phosphorylation | - | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEH1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEH1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEH1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...