UniProt ID | TM214_HUMAN | |
---|---|---|
UniProt AC | Q6NUQ4 | |
Protein Name | Transmembrane protein 214 | |
Gene Name | TMEM214 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 689 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Critical mediator, in cooperation with CASP4, of endoplasmic reticulum-stress induced apoptosis. Required or the activation of CASP4 following endoplasmic reticulum stress.. | |
Protein Sequence | MATKTAGVGRWEVVKKGRRPGVGAGAGGRGGGRNRRALGEANGVWKYDLTPAIQTTSTLYERGFENIMKRQNKEQVPPPAVEPKKPGNKKQPKKVATPPNQNQKQGRFRSLEEALKALDVADLQKELDKSQSVFSGNPSIWLKDLASYLNYKLQAPLSEPTLSQHTHDYPYSLVSRELRGIIRGLLAKAAGSLELFFDHCLFTMLQELDKTPGESLHGYRICIQAILQDKPKIATANLGKFLELLRSHQSRPAKCLTIMWALGQAGFANLTEGLKVWLGIMLPVLGIKSLSPFAITYLDRLLLMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLTPSLQEQLCQLYPRLKVLAFGAKPDSTLHTYFPSFLSRATPSCPPEMKKELLSSLTECLTVDPLSASVWRQLYPKHLSQSSLLLEHLLSSWEQIPKKVQKSLQETIQSLKLTNQELLRKGSSNNQDVVTCDMACKGLLQQVQGPRLPWTRLLLLLLVFAVGFLCHDLRSHSSFQASLTGRLLRSSGFLPASQQACAKLYSYSLQGYSWLGETLPLWGSHLLTVVRPSLQLAWAHTNATVSFLSAHCASHLAWFGDSLTSLSQRLQIQLPDSVNQLLRYLRELPLLFHQNVLLPLWHLLLEALAWAQEHCHEACRGEVTWDCMKTQLSEAVHWTWLCLQDITVAFLDWALALISQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATKTAGVG ------CCCCCCCCC | 20.15 | 22814378 | |
4 | Ubiquitination | ----MATKTAGVGRW ----CCCCCCCCCCE | 27.17 | 33845483 | |
5 | Phosphorylation | ---MATKTAGVGRWE ---CCCCCCCCCCEE | 25.04 | 22210691 | |
29 | Dimethylation | VGAGAGGRGGGRNRR CCCCCCCCCCCCCCH | 39.40 | - | |
29 | Methylation | VGAGAGGRGGGRNRR CCCCCCCCCCCCCCH | 39.40 | 24394781 | |
33 | Methylation | AGGRGGGRNRRALGE CCCCCCCCCCHHHHC | 36.44 | 115918625 | |
47 | Phosphorylation | EANGVWKYDLTPAIQ CCCCEEEEECCCHHH | 10.65 | 20068231 | |
50 | Phosphorylation | GVWKYDLTPAIQTTS CEEEEECCCHHHHHH | 14.05 | 20068231 | |
55 | Phosphorylation | DLTPAIQTTSTLYER ECCCHHHHHHHHHHH | 19.32 | 20068231 | |
56 | Phosphorylation | LTPAIQTTSTLYERG CCCHHHHHHHHHHHH | 11.88 | 20068231 | |
57 | Phosphorylation | TPAIQTTSTLYERGF CCHHHHHHHHHHHHH | 21.58 | 28796482 | |
58 | Phosphorylation | PAIQTTSTLYERGFE CHHHHHHHHHHHHHH | 31.13 | 28796482 | |
60 | Phosphorylation | IQTTSTLYERGFENI HHHHHHHHHHHHHHH | 12.03 | 28796482 | |
69 | Methylation | RGFENIMKRQNKEQV HHHHHHHHHCCCCCC | 47.22 | 115979879 | |
69 | Ubiquitination | RGFENIMKRQNKEQV HHHHHHHHHCCCCCC | 47.22 | 29967540 | |
97 | Phosphorylation | KQPKKVATPPNQNQK CCCCCCCCCCCCCCC | 42.12 | 22167270 | |
104 | Ubiquitination | TPPNQNQKQGRFRSL CCCCCCCCCCCCCCH | 63.37 | 29967540 | |
107 | Ubiquitination | NQNQKQGRFRSLEEA CCCCCCCCCCCHHHH | 22.70 | 23000965 | |
110 | Phosphorylation | QKQGRFRSLEEALKA CCCCCCCCHHHHHHH | 37.10 | 23312004 | |
116 | Ubiquitination | RSLEEALKALDVADL CCHHHHHHHCCHHHH | 54.68 | 32015554 | |
125 | Ubiquitination | LDVADLQKELDKSQS CCHHHHHHHHHHHHH | 68.49 | 29967540 | |
129 | Acetylation | DLQKELDKSQSVFSG HHHHHHHHHHHCCCC | 64.12 | 26051181 | |
129 | Ubiquitination | DLQKELDKSQSVFSG HHHHHHHHHHHCCCC | 64.12 | 29967540 | |
187 | Ubiquitination | GIIRGLLAKAAGSLE HHHHHHHHHHHCCHH | 12.41 | 32142685 | |
195 | Ubiquitination | KAAGSLELFFDHCLF HHHCCHHHHHHHHHH | 6.68 | 21890473 | |
195 | Ubiquitination | KAAGSLELFFDHCLF HHHCCHHHHHHHHHH | 6.68 | 21890473 | |
195 | Ubiquitination | KAAGSLELFFDHCLF HHHCCHHHHHHHHHH | 6.68 | 21890473 | |
230 | Malonylation | IQAILQDKPKIATAN HHHHHCCCCCEEECC | 34.94 | 26320211 | |
232 | Ubiquitination | AILQDKPKIATANLG HHHCCCCCEEECCHH | 51.19 | 32142685 | |
240 | Ubiquitination | IATANLGKFLELLRS EEECCHHHHHHHHHH | 50.36 | 21906983 | |
269 | N-linked_Glycosylation | LGQAGFANLTEGLKV HHHCCCCCHHHHHHH | 45.28 | UniProtKB CARBOHYD | |
289 | Phosphorylation | LPVLGIKSLSPFAIT HHHHCCCCCCHHHHH | 31.96 | - | |
291 | Phosphorylation | VLGIKSLSPFAITYL HHCCCCCCHHHHHHH | 25.68 | - | |
305 | Ubiquitination | LDRLLLMHPNLTKGF HHHHHHHCCCCCCCC | 14.20 | 27667366 | |
307 | N-linked_Glycosylation | RLLLMHPNLTKGFGM HHHHHCCCCCCCCCC | 45.74 | UniProtKB CARBOHYD | |
312 | Ubiquitination | HPNLTKGFGMIGPKD CCCCCCCCCCCCCHH | 6.82 | 29967540 | |
337 | Ubiquitination | PNNSLTPSLQEQLCQ CCCCCCHHHHHHHHH | 37.13 | 33845483 | |
350 | Ubiquitination | CQLYPRLKVLAFGAK HHHHHHHHHHHCCCC | 36.16 | 27667366 | |
357 | Ubiquitination | KVLAFGAKPDSTLHT HHHHCCCCCCCCHHH | 50.14 | 29967540 | |
371 | Phosphorylation | TYFPSFLSRATPSCP HHCHHHHHHCCCCCC | 20.19 | 24719451 | |
382 | 2-Hydroxyisobutyrylation | PSCPPEMKKELLSSL CCCCHHHHHHHHHHH | 41.24 | - | |
382 | Ubiquitination | PSCPPEMKKELLSSL CCCCHHHHHHHHHHH | 41.24 | 33845483 | |
383 | Ubiquitination | SCPPEMKKELLSSLT CCCHHHHHHHHHHHH | 52.89 | - | |
389 | Ubiquitination | KKELLSSLTECLTVD HHHHHHHHHHHCCCC | 4.14 | 33845483 | |
399 | Ubiquitination | CLTVDPLSASVWRQL HCCCCCCCHHHHHHH | 24.72 | 21890473 | |
399 | Ubiquitination | CLTVDPLSASVWRQL HCCCCCCCHHHHHHH | 24.72 | 23000965 | |
399 | Ubiquitination | CLTVDPLSASVWRQL HCCCCCCCHHHHHHH | 24.72 | 21890473 | |
408 | Ubiquitination | SVWRQLYPKHLSQSS HHHHHHCCCCCCHHH | 26.61 | 29967540 | |
409 | Ubiquitination | VWRQLYPKHLSQSSL HHHHHCCCCCCHHHH | 43.55 | - | |
410 | Phosphorylation | WRQLYPKHLSQSSLL HHHHCCCCCCHHHHH | 26.64 | 33259812 | |
434 | Ubiquitination | QIPKKVQKSLQETIQ HHCHHHHHHHHHHHH | 57.00 | 33845483 | |
444 | Ubiquitination | QETIQSLKLTNQELL HHHHHHHHCCCHHHH | 59.52 | 23000965 | |
453 | Ubiquitination | TNQELLRKGSSNNQD CCHHHHHCCCCCCCC | 64.21 | 29967540 | |
455 | Phosphorylation | QELLRKGSSNNQDVV HHHHHCCCCCCCCCH | 32.69 | 25159151 | |
456 | Phosphorylation | ELLRKGSSNNQDVVT HHHHCCCCCCCCCHH | 48.76 | 25849741 | |
463 | Phosphorylation | SNNQDVVTCDMACKG CCCCCCHHHHHHHHH | 11.57 | 27251275 | |
470 | Ubiquitination | TCDMACKGLLQQVQG HHHHHHHHHHHHCCC | 31.35 | 21890473 | |
508 | Ubiquitination | LRSHSSFQASLTGRL HHCCCHHHHHHHHHH | 31.80 | 23000965 | |
529 | S-nitrosylation | LPASQQACAKLYSYS CCHHHHHHHHHHCCC | 2.74 | 2212679 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM214_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM214_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM214_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TM214_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...