UniProt ID | TIRR_HUMAN | |
---|---|---|
UniProt AC | Q9BRJ7 | |
Protein Name | Tudor-interacting repair regulator protein {ECO:0000303|PubMed:28241136} | |
Gene Name | NUDT16L1 {ECO:0000312|HGNC:HGNC:28154} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 211 | |
Subcellular Localization | Nucleus . | |
Protein Description | Key regulator of TP53BP1 required to stabilize TP53BP1 and regulate its recruitment to chromatin. [PubMed: 28241136 In absence of DNA damage, interacts with the tandem Tudor-like domain of TP53BP1, masking the region that binds histone H4 dimethylated at 'Lys-20' (H4K20me2), thereby preventing TP53BP1 recruitment to chromatin and maintaining TP53BP1 localization to the nucleus] | |
Protein Sequence | MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRRFWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVLGLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPASS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTAAVPEL ------CCCCCCHHH | 21406692 | ||
3 | Phosphorylation | -----MSTAAVPELK -----CCCCCCHHHH | 21406692 | ||
10 (in isoform 2) | Ubiquitination | - | - | ||
10 | Ubiquitination | TAAVPELKQISRVEA CCCCHHHHHHCCHHC | 28241136 | ||
13 | Phosphorylation | VPELKQISRVEAMRL CHHHHHHCCHHCCCC | 24719451 | ||
49 | Phosphorylation | GRIPMRFSVLMQMRF CCCCCCHHHHHHCCC | 20068231 | ||
96 | Phosphorylation | LRLTEADYLSSHLTE HHHHHHHHHHHHCCC | - | ||
148 | Phosphorylation | GLVRVPLYTQKDRVG EEEEEEECCCCCCCC | 29496907 | ||
151 | Succinylation | RVPLYTQKDRVGGFP EEEECCCCCCCCCCC | 23954790 | ||
151 | Ubiquitination | RVPLYTQKDRVGGFP EEEECCCCCCCCCCC | 21890473 | ||
151 (in isoform 1) | Ubiquitination | - | 21890473 | ||
164 (in isoform 2) | Phosphorylation | - | 22210691 | ||
165 (in isoform 2) | Phosphorylation | - | 22210691 | ||
177 (in isoform 2) | Phosphorylation | - | 22210691 | ||
187 | Ubiquitination | LNMMPEEKLVEALAA HHCCCHHHHHHHHHH | - | ||
198 | Ubiquitination | ALAAATEKQKKALEK HHHHCHHHHHHHHHH | 2190698 | ||
198 (in isoform 1) | Ubiquitination | - | 21890473 | ||
201 | Ubiquitination | AATEKQKKALEKLLP HCHHHHHHHHHHHCC | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIRR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIRR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
NUD16_HUMAN | NUDT16 | physical | 28514442 | |
TP53B_HUMAN | TP53BP1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...