| UniProt ID | TPC6A_HUMAN | |
|---|---|---|
| UniProt AC | O75865 | |
| Protein Name | Trafficking protein particle complex subunit 6A | |
| Gene Name | TRAPPC6A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 159 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. | |
| Protein Description | May play a role in vesicular transport during the biogenesis of melanosomes.. | |
| Protein Sequence | MADTVLFEFLHTEMVAELWAHDPDPGPGGQKMSLSVLEGMGFRVGQALGERLPRETLAFREELDVLKFLCKDLWVAVFQKQMDSLRTNHQGTYVLQDNSFPLLLPMASGLQYLEEAPKFLAFTCGLLRGALYTLGIESVVTASVAALPVCKFQVVIPKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 33 | Phosphorylation | GPGGQKMSLSVLEGM CCCCCCCCHHHHHCC | 25.24 | - | |
| 35 | Phosphorylation | GGQKMSLSVLEGMGF CCCCCCHHHHHCCCH | 19.83 | - | |
| 51 | Methylation | VGQALGERLPRETLA HHHHHHHCCCHHHHH | 48.47 | 115918933 | |
| 80 | Ubiquitination | LWVAVFQKQMDSLRT HHHHHHHHHHHHHCC | 35.80 | - | |
| 94 (in isoform 2) | Ubiquitination | - | 3.77 | - | |
| 112 | Phosphorylation | PMASGLQYLEEAPKF ECCHHHHHHHHHHHH | 22.56 | - | |
| 158 | Ubiquitination | KFQVVIPKS------ EEEEEEECC------ | 58.64 | - | |
| 172 (in isoform 2) | Ubiquitination | - | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPC6A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPC6A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPC6A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TPC10_HUMAN | TRAPPC10 | physical | 21525244 | |
| TPC12_HUMAN | TRAPPC12 | physical | 21525244 | |
| TPC6A_HUMAN | TRAPPC6A | physical | 21525244 | |
| TPC6B_HUMAN | TRAPPC6B | physical | 21525244 | |
| TPC2L_HUMAN | TRAPPC2L | physical | 21525244 | |
| TPC2A_HUMAN | TRAPPC2 | physical | 21525244 | |
| TPC2B_HUMAN | TRAPPC2 | physical | 21525244 | |
| TPPC3_HUMAN | TRAPPC3 | physical | 21525244 | |
| TPC3L_HUMAN | TRAPPC3L | physical | 21525244 | |
| ZMIZ2_HUMAN | ZMIZ2 | physical | 25416956 | |
| RAB3I_HUMAN | RAB3IP | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
