UniProt ID | TPC2L_HUMAN | |
---|---|---|
UniProt AC | Q9UL33 | |
Protein Name | Trafficking protein particle complex subunit 2-like protein | |
Gene Name | TRAPPC2L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 140 | |
Subcellular Localization | Cytoplasm, perinuclear region . Endoplasmic reticulum . Golgi apparatus . | |
Protein Description | May play a role in vesicular transport from endoplasmic reticulum to Golgi.. | |
Protein Sequence | MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | ENELKFHYMVHTSLD CCCEEEEEEEEECHH | 12.17 | 23663014 | |
34 | Phosphorylation | KFHYMVHTSLDVVDE EEEEEEEECHHHHHH | 21.41 | 23663014 | |
48 | Ubiquitination | EKISAMGKALVDQRE HHHHHHHHHHHHHHH | 26.01 | 21890473 | |
48 (in isoform 1) | Ubiquitination | - | 26.01 | 21890473 | |
48 (in isoform 2) | Ubiquitination | - | 26.01 | 21890473 | |
70 | Phosphorylation | PTEDYKVYGYVTNSK ECCCEEEEEEECCCC | 9.89 | 21406692 | |
72 | Phosphorylation | EDYKVYGYVTNSKVK CCEEEEEEECCCCEE | 6.09 | 21406692 | |
74 | Phosphorylation | YKVYGYVTNSKVKFV EEEEEEECCCCEEEE | 25.87 | 21406692 | |
76 | Phosphorylation | VYGYVTNSKVKFVMV EEEEECCCCEEEEEE | 29.47 | 21406692 | |
77 | Ubiquitination | YGYVTNSKVKFVMVV EEEECCCCEEEEEEE | 52.06 | - | |
86 | Phosphorylation | KFVMVVDSSNTALRD EEEEEECCCCCCCCH | 17.55 | 20071362 | |
89 | Phosphorylation | MVVDSSNTALRDNEI EEECCCCCCCCHHHH | 29.08 | 20071362 | |
102 | Ubiquitination | EIRSMFRKLHNSYTD HHHHHHHHHHHHCCC | 42.72 | - | |
106 | Phosphorylation | MFRKLHNSYTDVMCN HHHHHHHHCCCCCCC | 20.75 | - | |
107 | Phosphorylation | FRKLHNSYTDVMCNP HHHHHHHCCCCCCCC | 16.57 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPC2L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPC2L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPC2L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPPC3_HUMAN | TRAPPC3 | physical | 21453443 | |
TPC13_HUMAN | TRAPPC13 | physical | 21453443 | |
TPPC8_HUMAN | TRAPPC8 | physical | 21453443 | |
TPPC8_HUMAN | TRAPPC8 | physical | 21525244 | |
TPC10_HUMAN | TRAPPC10 | physical | 21525244 | |
TPPC9_HUMAN | TRAPPC9 | physical | 21525244 | |
TPC12_HUMAN | TRAPPC12 | physical | 21525244 | |
TPC11_HUMAN | TRAPPC11 | physical | 21525244 | |
TPPC3_HUMAN | TRAPPC3 | physical | 21525244 | |
TPC3L_HUMAN | TRAPPC3L | physical | 21525244 | |
TPC6A_HUMAN | TRAPPC6A | physical | 21525244 | |
TPC6B_HUMAN | TRAPPC6B | physical | 21525244 | |
TPC2L_HUMAN | TRAPPC2L | physical | 21525244 | |
A4_HUMAN | APP | physical | 21832049 | |
REPS1_HUMAN | REPS1 | physical | 25416956 | |
CE57L_HUMAN | CEP57L1 | physical | 25416956 | |
TPC10_HUMAN | TRAPPC10 | physical | 27173435 | |
PDLI7_HUMAN | PDLIM7 | physical | 27173435 | |
M21D2_HUMAN | MB21D2 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...