| UniProt ID | TPC3L_HUMAN | |
|---|---|---|
| UniProt AC | Q5T215 | |
| Protein Name | Trafficking protein particle complex subunit 3-like protein | |
| Gene Name | TRAPPC3L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 181 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. | |
| Protein Description | May play a role in vesicular transport from endoplasmic reticulum to Golgi.. | |
| Protein Sequence | MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFLARSCVGRCHSYSEIIDIIAQVAFKMYLGITPSVTCNNSSKNEFSLILEKNPLVEFVEELPAGRSSLCYCNLLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRGKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | Ubiquitination | QLCKDYEKDEDVNQY HHHHHCCCCHHHHHH | 61.25 | 29967540 | |
| 63 | Phosphorylation | VEDFLARSCVGRCHS HHHHHHHHCCCCCCC | 13.93 | - | |
| 68 | S-palmitoylation | ARSCVGRCHSYSEII HHHCCCCCCCHHHHH | 1.74 | - | |
| 90 | Phosphorylation | FKMYLGITPSVTCNN HHHHHCCCCCCEECC | 14.02 | 22210691 | |
| 160 | Phosphorylation | QDRLKGDSVTEIGIT HHHHCCCCEEEEEEE | 39.34 | 24702127 | |
| 162 | Phosphorylation | RLKGDSVTEIGITFL HHCCCCEEEEEEEEE | 26.32 | 24702127 | |
| 167 | Phosphorylation | SVTEIGITFLKKRDE CEEEEEEEEEHHHCC | 20.08 | 24702127 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPC3L_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPC3L_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPC3L_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TPPC4_HUMAN | TRAPPC4 | physical | 21525244 | |
| TPPC8_HUMAN | TRAPPC8 | physical | 21525244 | |
| TPPC9_HUMAN | TRAPPC9 | physical | 21525244 | |
| TPC10_HUMAN | TRAPPC10 | physical | 21525244 | |
| TPC11_HUMAN | TRAPPC11 | physical | 21525244 | |
| TPC12_HUMAN | TRAPPC12 | physical | 21525244 | |
| TPPC5_HUMAN | TRAPPC5 | physical | 21525244 | |
| TPC6A_HUMAN | TRAPPC6A | physical | 21525244 | |
| TPC6B_HUMAN | TRAPPC6B | physical | 21525244 | |
| TPC2L_HUMAN | TRAPPC2L | physical | 21525244 | |
| TPC2A_HUMAN | TRAPPC2 | physical | 21525244 | |
| TPC2B_HUMAN | TRAPPC2 | physical | 21525244 | |
| TPPC1_HUMAN | TRAPPC1 | physical | 21525244 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
