| UniProt ID | TPPC1_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5R8 | |
| Protein Name | Trafficking protein particle complex subunit 1 | |
| Gene Name | TRAPPC1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 145 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. | |
| Protein Description | May play a role in vesicular transport from endoplasmic reticulum to Golgi.. | |
| Protein Sequence | MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTVHNLYLF ------CCEEEEEEE | 30.39 | 22210691 | |
| 7 | Phosphorylation | -MTVHNLYLFDRNGV -CCEEEEEEECCCCE | 15.61 | 22210691 | |
| 18 | Phosphorylation | RNGVCLHYSEWHRKK CCCEEEEHHHHHHHH | 8.71 | 22210691 | |
| 19 | Phosphorylation | NGVCLHYSEWHRKKQ CCEEEEHHHHHHHHH | 24.38 | 22210691 | |
| 25 | Acetylation | YSEWHRKKQAGIPKE HHHHHHHHHCCCCHH | 45.39 | 7365693 | |
| 25 | Ubiquitination | YSEWHRKKQAGIPKE HHHHHHHHHCCCCHH | 45.39 | 27667366 | |
| 31 | Acetylation | KKQAGIPKEEEYKLM HHHCCCCHHHHHHHH | 75.69 | 7365703 | |
| 39 | Phosphorylation | EEEYKLMYGMLFSIR HHHHHHHHHHHHHHH | 15.15 | - | |
| 51 | Ubiquitination | SIRSFVSKMSPLDMK HHHHHHHHCCCCCCC | 37.79 | 33845483 | |
| 53 | Phosphorylation | RSFVSKMSPLDMKDG HHHHHHCCCCCCCCC | 26.50 | 22210691 | |
| 58 | Ubiquitination | KMSPLDMKDGFLAFQ HCCCCCCCCCEEEEE | 55.13 | 23000965 | |
| 66 | Phosphorylation | DGFLAFQTSRYKLHY CCEEEEECEEEEEEE | 14.55 | 22210691 | |
| 67 | Phosphorylation | GFLAFQTSRYKLHYY CEEEEECEEEEEEEE | 23.88 | 22210691 | |
| 70 | Ubiquitination | AFQTSRYKLHYYETP EEECEEEEEEEEECC | 27.90 | 22817900 | |
| 73 | Phosphorylation | TSRYKLHYYETPTGI CEEEEEEEEECCCCE | 17.27 | 22817900 | |
| 74 | Phosphorylation | SRYKLHYYETPTGIK EEEEEEEEECCCCEE | 11.54 | 29496907 | |
| 76 | Phosphorylation | YKLHYYETPTGIKVV EEEEEEECCCCEEEE | 15.27 | 29496907 | |
| 86 | Phosphorylation | GIKVVMNTDLGVGPI CEEEEECCCCCCCCH | 17.95 | 21406692 | |
| 128 | Phosphorylation | VQSELFRSRLDSYVR HHHHHHHHHHHHHHH | 29.84 | 22985185 | |
| 129 | Methylation | QSELFRSRLDSYVRS HHHHHHHHHHHHHHH | 37.95 | 115918929 | |
| 132 | Phosphorylation | LFRSRLDSYVRSLPF HHHHHHHHHHHHCCC | 30.07 | 17001009 | |
| 133 | Phosphorylation | FRSRLDSYVRSLPFF HHHHHHHHHHHCCCC | 10.27 | 23312004 | |
| 141 | Phosphorylation | VRSLPFFSARAG--- HHHCCCCCCCCC--- | 19.75 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPPC1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPPC1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPPC1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
