| UniProt ID | TPC13_HUMAN | |
|---|---|---|
| UniProt AC | A5PLN9 | |
| Protein Name | Trafficking protein particle complex subunit 13 | |
| Gene Name | TRAPPC13 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 417 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNMTTSPMFMEKVSLEPSIMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVES | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Ubiquitination | -MEVNPPKQEHLLAL -CCCCCCHHHHHHHH | - | ||
| 8 | Ubiquitination | MEVNPPKQEHLLALK CCCCCCHHHHHHHHH | 21890473 | ||
| 15 | Ubiquitination | QEHLLALKVMRLTKP HHHHHHHHHHHCCCC | - | ||
| 21 | Ubiquitination | LKVMRLTKPTLFTNI HHHHHCCCCCEECCC | 29967540 | ||
| 93 | Ubiquitination | VHNDSNQVVKDILVK EECCCCCCHHHHEEE | 32015554 | ||
| 100 | Ubiquitination | VVKDILVKADLQTSS CHHHHEEEECCCCHH | 29967540 | ||
| 101 | Ubiquitination | VKDILVKADLQTSSQ HHHHEEEECCCCHHH | 33845483 | ||
| 106 | Ubiquitination | VKADLQTSSQRLNLS EEECCCCHHHHHCCH | 27667366 | ||
| 107 (in isoform 5) | Ubiquitination | - | 21890473 | ||
| 150 | Phosphorylation | ILVCAVSYTTQAGEK EEEEEEEEECCCCCE | - | ||
| 165 | Ubiquitination | MYFRKFFKFQVLKPL EEEEEEEEEEEECCC | 21890473 | ||
| 165 | Acetylation | MYFRKFFKFQVLKPL EEEEEEEEEEEECCC | 25953088 | ||
| 165 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 165 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 165 (in isoform 5) | Ubiquitination | - | 21890473 | ||
| 165 (in isoform 4) | Ubiquitination | - | 21890473 | ||
| 165 (in isoform 7) | Ubiquitination | - | 21890473 | ||
| 170 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 170 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 170 (in isoform 4) | Ubiquitination | - | 21890473 | ||
| 170 (in isoform 7) | Ubiquitination | - | 21890473 | ||
| 170 | Ubiquitination | FFKFQVLKPLDVKTK EEEEEEECCCCCCCC | 21906983 | ||
| 177 | Ubiquitination | KPLDVKTKFYNAESD CCCCCCCCEECCCCC | - | ||
| 179 | Phosphorylation | LDVKTKFYNAESDLS CCCCCCEECCCCCHH | 22210691 | ||
| 183 | Phosphorylation | TKFYNAESDLSSVTD CCEECCCCCHHHCCH | 22210691 | ||
| 186 | Phosphorylation | YNAESDLSSVTDEVF ECCCCCHHHCCHHHH | 22210691 | ||
| 187 | Phosphorylation | NAESDLSSVTDEVFL CCCCCHHHCCHHHHH | 22210691 | ||
| 189 | Phosphorylation | ESDLSSVTDEVFLEA CCCHHHCCHHHHHHH | 22210691 | ||
| 201 (in isoform 5) | Ubiquitination | - | 21890473 | ||
| 202 | Phosphorylation | EAQIQNMTTSPMFME HHHHHCCCCCCCCCC | 22210691 | ||
| 203 | Phosphorylation | AQIQNMTTSPMFMEK HHHHCCCCCCCCCCC | 22210691 | ||
| 232 | Ubiquitination | NSVSQAGECVSTFGS CCCCCCCCHHHHHCC | 33845483 | ||
| 233 | Ubiquitination | SVSQAGECVSTFGSR CCCCCCCHHHHHCCC | 33845483 | ||
| 250 | Ubiquitination | LQPMDTRQYLYCLKP ECCCCHHHHEEEECC | 32015554 | ||
| 256 | Ubiquitination | RQYLYCLKPKNEFAE HHHEEEECCCCHHHH | 32015554 | ||
| 258 (in isoform 7) | Ubiquitination | - | 21890473 | ||
| 258 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 258 | Ubiquitination | YLYCLKPKNEFAEKA HEEEECCCCHHHHHH | 27667366 | ||
| 263 | Ubiquitination | KPKNEFAEKAGIIKG CCCCHHHHHHCCCCC | 27667366 | ||
| 264 | Ubiquitination | PKNEFAEKAGIIKGV CCCHHHHHHCCCCCE | 21906983 | ||
| 264 (in isoform 4) | Ubiquitination | - | 21890473 | ||
| 264 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 269 | Ubiquitination | AEKAGIIKGVTVIGK HHHHCCCCCEEEEEE | 27667366 | ||
| 303 | Phosphorylation | LQRMAPGYGDVRLSL HHHHCCCCCCEEEEE | - | ||
| 309 | Phosphorylation | GYGDVRLSLEAIPDT CCCCEEEEEEECCCC | 24719451 | ||
| 328 | Ubiquitination | EPFHITCKITNCSER CCEEEEEEECCCCHH | - | ||
| 333 (in isoform 5) | Ubiquitination | - | 21890473 | ||
| 355 | Phosphorylation | SIHWCGISGRQLGKL CCEEEECCCCCCCCC | - | ||
| 365 | Phosphorylation | QLGKLHPSSSLCLAL CCCCCCCCHHHHHHH | 24043423 | ||
| 366 | Phosphorylation | LGKLHPSSSLCLALT CCCCCCCHHHHHHHH | 24043423 | ||
| 367 | Phosphorylation | GKLHPSSSLCLALTL CCCCCCHHHHHHHHH | 24043423 | ||
| 373 | Phosphorylation | SSLCLALTLLSSVQG HHHHHHHHHHHHHCC | 24043423 | ||
| 376 | Phosphorylation | CLALTLLSSVQGLQS HHHHHHHHHHCCHHH | 24043423 | ||
| 377 | Phosphorylation | LALTLLSSVQGLQSI HHHHHHHHHCCHHHC | 24043423 | ||
| 383 | Phosphorylation | SSVQGLQSISGLRLT HHHCCHHHCCCCCCC | 24043423 | ||
| 385 | Phosphorylation | VQGLQSISGLRLTDT HCCHHHCCCCCCCCC | 24719451 | ||
| 389 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 389 | Ubiquitination | QSISGLRLTDTFLKR HHCCCCCCCCCHHHH | 33845483 | ||
| 390 | Ubiquitination | SISGLRLTDTFLKRT HCCCCCCCCCHHHHH | 33845483 | ||
| 395 | Ubiquitination | RLTDTFLKRTYEYDD CCCCCHHHHHCCCCC | 33845483 | ||
| 395 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 396 | Ubiquitination | LTDTFLKRTYEYDDI CCCCHHHHHCCCCCH | 33845483 | ||
| 396 (in isoform 4) | Ubiquitination | - | 21890473 | ||
| 396 (in isoform 5) | Ubiquitination | - | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPC13_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPC13_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPC13_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TPPC3_HUMAN | TRAPPC3 | physical | 21453443 | |
| TPPC8_HUMAN | TRAPPC8 | physical | 21453443 | |
| UBB_HUMAN | UBB | physical | 26186194 | |
| COG6_HUMAN | COG6 | physical | 26186194 | |
| TPC12_HUMAN | TRAPPC12 | physical | 26186194 | |
| TPC12_HUMAN | TRAPPC12 | physical | 28514442 | |
| COG6_HUMAN | COG6 | physical | 28514442 | |
| UBB_HUMAN | UBB | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...