UniProt ID | TPC13_HUMAN | |
---|---|---|
UniProt AC | A5PLN9 | |
Protein Name | Trafficking protein particle complex subunit 13 | |
Gene Name | TRAPPC13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 417 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEVNPPKQEHLLALKVMRLTKPTLFTNIPVTCEEKDLPGDLFNQLMRDDPSTVNGAEVLMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNMTTSPMFMEKVSLEPSIMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Ubiquitination | -MEVNPPKQEHLLAL -CCCCCCHHHHHHHH | - | ||
8 | Ubiquitination | MEVNPPKQEHLLALK CCCCCCHHHHHHHHH | 21890473 | ||
15 | Ubiquitination | QEHLLALKVMRLTKP HHHHHHHHHHHCCCC | - | ||
21 | Ubiquitination | LKVMRLTKPTLFTNI HHHHHCCCCCEECCC | 29967540 | ||
93 | Ubiquitination | VHNDSNQVVKDILVK EECCCCCCHHHHEEE | 32015554 | ||
100 | Ubiquitination | VVKDILVKADLQTSS CHHHHEEEECCCCHH | 29967540 | ||
101 | Ubiquitination | VKDILVKADLQTSSQ HHHHEEEECCCCHHH | 33845483 | ||
106 | Ubiquitination | VKADLQTSSQRLNLS EEECCCCHHHHHCCH | 27667366 | ||
107 (in isoform 5) | Ubiquitination | - | 21890473 | ||
150 | Phosphorylation | ILVCAVSYTTQAGEK EEEEEEEEECCCCCE | - | ||
165 | Ubiquitination | MYFRKFFKFQVLKPL EEEEEEEEEEEECCC | 21890473 | ||
165 | Acetylation | MYFRKFFKFQVLKPL EEEEEEEEEEEECCC | 25953088 | ||
165 (in isoform 1) | Ubiquitination | - | 21890473 | ||
165 (in isoform 2) | Ubiquitination | - | 21890473 | ||
165 (in isoform 5) | Ubiquitination | - | 21890473 | ||
165 (in isoform 4) | Ubiquitination | - | 21890473 | ||
165 (in isoform 7) | Ubiquitination | - | 21890473 | ||
170 (in isoform 2) | Ubiquitination | - | 21890473 | ||
170 (in isoform 1) | Ubiquitination | - | 21890473 | ||
170 (in isoform 4) | Ubiquitination | - | 21890473 | ||
170 (in isoform 7) | Ubiquitination | - | 21890473 | ||
170 | Ubiquitination | FFKFQVLKPLDVKTK EEEEEEECCCCCCCC | 21906983 | ||
177 | Ubiquitination | KPLDVKTKFYNAESD CCCCCCCCEECCCCC | - | ||
179 | Phosphorylation | LDVKTKFYNAESDLS CCCCCCEECCCCCHH | 22210691 | ||
183 | Phosphorylation | TKFYNAESDLSSVTD CCEECCCCCHHHCCH | 22210691 | ||
186 | Phosphorylation | YNAESDLSSVTDEVF ECCCCCHHHCCHHHH | 22210691 | ||
187 | Phosphorylation | NAESDLSSVTDEVFL CCCCCHHHCCHHHHH | 22210691 | ||
189 | Phosphorylation | ESDLSSVTDEVFLEA CCCHHHCCHHHHHHH | 22210691 | ||
201 (in isoform 5) | Ubiquitination | - | 21890473 | ||
202 | Phosphorylation | EAQIQNMTTSPMFME HHHHHCCCCCCCCCC | 22210691 | ||
203 | Phosphorylation | AQIQNMTTSPMFMEK HHHHCCCCCCCCCCC | 22210691 | ||
232 | Ubiquitination | NSVSQAGECVSTFGS CCCCCCCCHHHHHCC | 33845483 | ||
233 | Ubiquitination | SVSQAGECVSTFGSR CCCCCCCHHHHHCCC | 33845483 | ||
250 | Ubiquitination | LQPMDTRQYLYCLKP ECCCCHHHHEEEECC | 32015554 | ||
256 | Ubiquitination | RQYLYCLKPKNEFAE HHHEEEECCCCHHHH | 32015554 | ||
258 (in isoform 7) | Ubiquitination | - | 21890473 | ||
258 (in isoform 2) | Ubiquitination | - | 21890473 | ||
258 | Ubiquitination | YLYCLKPKNEFAEKA HEEEECCCCHHHHHH | 27667366 | ||
263 | Ubiquitination | KPKNEFAEKAGIIKG CCCCHHHHHHCCCCC | 27667366 | ||
264 | Ubiquitination | PKNEFAEKAGIIKGV CCCHHHHHHCCCCCE | 21906983 | ||
264 (in isoform 4) | Ubiquitination | - | 21890473 | ||
264 (in isoform 1) | Ubiquitination | - | 21890473 | ||
269 | Ubiquitination | AEKAGIIKGVTVIGK HHHHCCCCCEEEEEE | 27667366 | ||
303 | Phosphorylation | LQRMAPGYGDVRLSL HHHHCCCCCCEEEEE | - | ||
309 | Phosphorylation | GYGDVRLSLEAIPDT CCCCEEEEEEECCCC | 24719451 | ||
328 | Ubiquitination | EPFHITCKITNCSER CCEEEEEEECCCCHH | - | ||
333 (in isoform 5) | Ubiquitination | - | 21890473 | ||
355 | Phosphorylation | SIHWCGISGRQLGKL CCEEEECCCCCCCCC | - | ||
365 | Phosphorylation | QLGKLHPSSSLCLAL CCCCCCCCHHHHHHH | 24043423 | ||
366 | Phosphorylation | LGKLHPSSSLCLALT CCCCCCCHHHHHHHH | 24043423 | ||
367 | Phosphorylation | GKLHPSSSLCLALTL CCCCCCHHHHHHHHH | 24043423 | ||
373 | Phosphorylation | SSLCLALTLLSSVQG HHHHHHHHHHHHHCC | 24043423 | ||
376 | Phosphorylation | CLALTLLSSVQGLQS HHHHHHHHHHCCHHH | 24043423 | ||
377 | Phosphorylation | LALTLLSSVQGLQSI HHHHHHHHHCCHHHC | 24043423 | ||
383 | Phosphorylation | SSVQGLQSISGLRLT HHHCCHHHCCCCCCC | 24043423 | ||
385 | Phosphorylation | VQGLQSISGLRLTDT HCCHHHCCCCCCCCC | 24719451 | ||
389 (in isoform 2) | Ubiquitination | - | 21890473 | ||
389 | Ubiquitination | QSISGLRLTDTFLKR HHCCCCCCCCCHHHH | 33845483 | ||
390 | Ubiquitination | SISGLRLTDTFLKRT HCCCCCCCCCHHHHH | 33845483 | ||
395 | Ubiquitination | RLTDTFLKRTYEYDD CCCCCHHHHHCCCCC | 33845483 | ||
395 (in isoform 1) | Ubiquitination | - | 21890473 | ||
396 | Ubiquitination | LTDTFLKRTYEYDDI CCCCHHHHHCCCCCH | 33845483 | ||
396 (in isoform 4) | Ubiquitination | - | 21890473 | ||
396 (in isoform 5) | Ubiquitination | - | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPC13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPC13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPC13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPPC3_HUMAN | TRAPPC3 | physical | 21453443 | |
TPPC8_HUMAN | TRAPPC8 | physical | 21453443 | |
UBB_HUMAN | UBB | physical | 26186194 | |
COG6_HUMAN | COG6 | physical | 26186194 | |
TPC12_HUMAN | TRAPPC12 | physical | 26186194 | |
TPC12_HUMAN | TRAPPC12 | physical | 28514442 | |
COG6_HUMAN | COG6 | physical | 28514442 | |
UBB_HUMAN | UBB | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...