| UniProt ID | TPPC3_HUMAN | |
|---|---|---|
| UniProt AC | O43617 | |
| Protein Name | Trafficking protein particle complex subunit 3 | |
| Gene Name | TRAPPC3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 180 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. | |
| Protein Description | May play a role in vesicular transport from endoplasmic reticulum to Golgi.. | |
| Protein Sequence | MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 42 | Ubiquitination | ENDEDVNKQLDKMGF CCCHHHHHHHHHHCC | 52.68 | 21906983 | |
| 46 | Ubiquitination | DVNKQLDKMGFNIGV HHHHHHHHHCCHHHH | 49.90 | 21890473 | |
| 68 | S-palmitoylation | ARSNVGRCHDFRETA HHCCCCCCCCHHHHH | 2.72 | 15692564 | |
| 156 | Ubiquitination | KFVQDTLKGDGVTEI HHHHHHHCCCCCCHH | 57.98 | 2190698 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPPC3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPPC3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPPC3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TPC6A_HUMAN | TRAPPC6A | physical | 16189514 | |
| TPC2L_HUMAN | TRAPPC2L | physical | 16189514 | |
| TPC13_HUMAN | TRAPPC13 | physical | 21453443 | |
| TPPC8_HUMAN | TRAPPC8 | physical | 21453443 | |
| TPPC5_HUMAN | TRAPPC5 | physical | 21525244 | |
| TPC6A_HUMAN | TRAPPC6A | physical | 21525244 | |
| TPC6B_HUMAN | TRAPPC6B | physical | 21525244 | |
| TPC2L_HUMAN | TRAPPC2L | physical | 21525244 | |
| TPC2A_HUMAN | TRAPPC2 | physical | 21525244 | |
| TPC2B_HUMAN | TRAPPC2 | physical | 21525244 | |
| TPPC1_HUMAN | TRAPPC1 | physical | 21525244 | |
| A4_HUMAN | APP | physical | 21832049 | |
| TPC2L_HUMAN | TRAPPC2L | physical | 25416956 | |
| TPC6A_HUMAN | TRAPPC6A | physical | 25416956 | |
| PKHF2_HUMAN | PLEKHF2 | physical | 25416956 | |
| TPC10_HUMAN | TRAPPC10 | physical | 27173435 | |
| TPPC4_HUMAN | TRAPPC4 | physical | 27173435 | |
| RAB3I_HUMAN | RAB3IP | physical | 27173435 | |
| TPC2L_HUMAN | TRAPPC2L | physical | 27173435 | |
| TM102_HUMAN | TMEM102 | physical | 27173435 | |
| M21D2_HUMAN | MB21D2 | physical | 27173435 | |
| PDLI7_HUMAN | PDLIM7 | physical | 27173435 | |
| R3GEF_HUMAN | RAB3IL1 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Palmitoylation | |
| Reference | PubMed |
| "Structure of palmitoylated BET3: insights into TRAPP complex assemblyand membrane localization."; Turnbull A.P., Kummel D., Prinz B., Holz C., Schultchen J., Lang C.,Niesen F.H., Hofmann K.P., Delbruck H., Behlke J., Muller E.C.,Jarosch E., Sommer T., Heinemann U.; EMBO J. 24:875-884(2005). Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 2-180, SUBUNIT, MUTAGENESISOF CYS-68, AND PALMITOYLATION AT CYS-68. | |