UniProt ID | TPPC3_HUMAN | |
---|---|---|
UniProt AC | O43617 | |
Protein Name | Trafficking protein particle complex subunit 3 | |
Gene Name | TRAPPC3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. | |
Protein Description | May play a role in vesicular transport from endoplasmic reticulum to Golgi.. | |
Protein Sequence | MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | Ubiquitination | ENDEDVNKQLDKMGF CCCHHHHHHHHHHCC | 52.68 | 21906983 | |
46 | Ubiquitination | DVNKQLDKMGFNIGV HHHHHHHHHCCHHHH | 49.90 | 21890473 | |
68 | S-palmitoylation | ARSNVGRCHDFRETA HHCCCCCCCCHHHHH | 2.72 | 15692564 | |
156 | Ubiquitination | KFVQDTLKGDGVTEI HHHHHHHCCCCCCHH | 57.98 | 2190698 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPPC3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPPC3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPPC3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TPC6A_HUMAN | TRAPPC6A | physical | 16189514 | |
TPC2L_HUMAN | TRAPPC2L | physical | 16189514 | |
TPC13_HUMAN | TRAPPC13 | physical | 21453443 | |
TPPC8_HUMAN | TRAPPC8 | physical | 21453443 | |
TPPC5_HUMAN | TRAPPC5 | physical | 21525244 | |
TPC6A_HUMAN | TRAPPC6A | physical | 21525244 | |
TPC6B_HUMAN | TRAPPC6B | physical | 21525244 | |
TPC2L_HUMAN | TRAPPC2L | physical | 21525244 | |
TPC2A_HUMAN | TRAPPC2 | physical | 21525244 | |
TPC2B_HUMAN | TRAPPC2 | physical | 21525244 | |
TPPC1_HUMAN | TRAPPC1 | physical | 21525244 | |
A4_HUMAN | APP | physical | 21832049 | |
TPC2L_HUMAN | TRAPPC2L | physical | 25416956 | |
TPC6A_HUMAN | TRAPPC6A | physical | 25416956 | |
PKHF2_HUMAN | PLEKHF2 | physical | 25416956 | |
TPC10_HUMAN | TRAPPC10 | physical | 27173435 | |
TPPC4_HUMAN | TRAPPC4 | physical | 27173435 | |
RAB3I_HUMAN | RAB3IP | physical | 27173435 | |
TPC2L_HUMAN | TRAPPC2L | physical | 27173435 | |
TM102_HUMAN | TMEM102 | physical | 27173435 | |
M21D2_HUMAN | MB21D2 | physical | 27173435 | |
PDLI7_HUMAN | PDLIM7 | physical | 27173435 | |
R3GEF_HUMAN | RAB3IL1 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Palmitoylation | |
Reference | PubMed |
"Structure of palmitoylated BET3: insights into TRAPP complex assemblyand membrane localization."; Turnbull A.P., Kummel D., Prinz B., Holz C., Schultchen J., Lang C.,Niesen F.H., Hofmann K.P., Delbruck H., Behlke J., Muller E.C.,Jarosch E., Sommer T., Heinemann U.; EMBO J. 24:875-884(2005). Cited for: X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 2-180, SUBUNIT, MUTAGENESISOF CYS-68, AND PALMITOYLATION AT CYS-68. |