UniProt ID | NGF_HUMAN | |
---|---|---|
UniProt AC | P01138 | |
Protein Name | Beta-nerve growth factor | |
Gene Name | NGF | |
Organism | Homo sapiens (Human). | |
Sequence Length | 241 | |
Subcellular Localization | Secreted. | |
Protein Description | Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI. [PubMed: 20164177] | |
Protein Sequence | MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | O-linked_Glycosylation | HWTKLQHSLDTALRR HHHHHHHHHHHHHHH | 18.25 | 55823607 | |
46 | O-linked_Glycosylation | KLQHSLDTALRRARS HHHHHHHHHHHHHHH | 32.65 | 55823613 | |
69 | N-linked_Glycosylation | RVAGQTRNITVDPRL HHCCCCCCCCCCHHH | 37.36 | UniProtKB CARBOHYD | |
84 | Phosphorylation | FKKRRLRSPRVLFST HHHCCCCCCCEEEEC | 22.96 | 24719451 | |
90 | Phosphorylation | RSPRVLFSTQPPREA CCCCEEEECCCCCCC | 23.21 | 24425749 | |
100 | Phosphorylation | PPREAADTQDLDFEV CCCCCCCCCCCCEEE | 21.18 | 24425749 | |
114 | N-linked_Glycosylation | VGGAAPFNRTHRSKR ECCCCCCCCCCCCCC | 47.05 | UniProtKB CARBOHYD | |
155 | Acetylation | TATDIKGKEVMVLGE CCCCCCCCEEEEEEE | 41.98 | 19820847 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NGF_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NGF_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
84 | Phosphorylation | 80 (4) | R ⇒ Q | rs11466111 |
| 28135244 |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TNR16_HUMAN | NGFR | physical | 14985763 | |
NTRK1_HUMAN | NTRK1 | physical | 14985763 | |
NTRK1_HUMAN | NTRK1 | physical | 11729324 | |
TNR16_HUMAN | NGFR | physical | 11729324 | |
TNR16_RAT | Ngfr | physical | 18596692 | |
NTRK1_HUMAN | NTRK1 | physical | 11738045 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
608654 | Neuropathy, hereditary sensory and autonomic, 5 (HSAN5) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-84, AND MASSSPECTROMETRY. |