UniProt ID | TPPP_BOVIN | |
---|---|---|
UniProt AC | Q27957 | |
Protein Name | Tubulin polymerization-promoting protein | |
Gene Name | TPPP | |
Organism | Bos taurus (Bovine). | |
Sequence Length | 218 | |
Subcellular Localization | Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. | |
Protein Description | May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.. | |
Protein Sequence | MADSRPKPANKTPPKSPGEPAKDKAAKRLSLEAEGAGEGAAAAGAELSALEEAFRKFAVHGDARASGREMHGKNWSKLCRDCQVIDGRSVTVTDVDIVFSKIKGKSCRTITFEQFKEALEELAKKRFKDKSAEEAVREVHKLIEGKAPIISGVTKAISSPTVSRLTDTSKFTGSHKERFDPSGRGKGRAGRVDLVDESGYVPGYKHAGTYDQKVQGGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | RPKPANKTPPKSPGE CCCCCCCCCCCCCCC | 44.63 | 17693641 | |
16 | Phosphorylation | ANKTPPKSPGEPAKD CCCCCCCCCCCCCCC | 43.86 | 17693641 | |
30 | Phosphorylation | DKAAKRLSLEAEGAG CHHHHHHCCHHCCCC | 28.35 | 17693641 | |
91 | Phosphorylation | VIDGRSVTVTDVDIV EECCCEEEEEEEEEE | 20.95 | - | |
106 | Phosphorylation | FSKIKGKSCRTITFE EEEECCCCCCEEEHH | 19.94 | - | |
151 | O-linked_Glycosylation | EGKAPIISGVTKAIS CCCCCCCCCHHHHHC | 28.12 | - | |
158 | Phosphorylation | SGVTKAISSPTVSRL CCHHHHHCCCCHHHC | 34.81 | - | |
159 | Phosphorylation | GVTKAISSPTVSRLT CHHHHHCCCCHHHCC | 20.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPPP_BOVIN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPPP_BOVIN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPPP_BOVIN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
G3P_BOVIN | GAPDH | physical | 17027006 | |
EF1A1_BOVIN | EEF1A1 | physical | 17027006 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphorylation blocks the activity of tubulin polymerization-promoting protein (TPPP): identification of sites targeted bydifferent kinases."; Hlavanda E., Klement E., Kokai E., Kovacs J., Vincze O., Toekesi N.,Orosz F., Medzihradszky K.F., Dombradi V., Ovadi J.; J. Biol. Chem. 282:29531-29539(2007). Cited for: IDENTIFICATION BY MASS SPECTROMETRY, PHOSPHORYLATION AT THR-12; SER-16AND SER-30, AND INTERACTION WITH MAPK1. |