UniProt ID | CRGC_HUMAN | |
---|---|---|
UniProt AC | P07315 | |
Protein Name | Gamma-crystallin C | |
Gene Name | CRYGC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 174 | |
Subcellular Localization | ||
Protein Description | Crystallins are the dominant structural components of the vertebrate eye lens.. | |
Protein Sequence | MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MGKITFYEDRAF ---CCCEEEEECCCC | 24.53 | 25404012 | |
7 | Phosphorylation | -MGKITFYEDRAFQG -CCCEEEEECCCCCC | 14.31 | 25404012 | |
16 | Phosphorylation | DRAFQGRSYETTTDC CCCCCCCCEEECCCC | 33.86 | 24043423 | |
17 | Phosphorylation | RAFQGRSYETTTDCP CCCCCCCEEECCCCC | 18.88 | 24043423 | |
19 | Phosphorylation | FQGRSYETTTDCPNL CCCCCEEECCCCCCC | 27.11 | 24043423 | |
20 | Phosphorylation | QGRSYETTTDCPNLQ CCCCEEECCCCCCCH | 14.54 | 24043423 | |
21 | Phosphorylation | GRSYETTTDCPNLQP CCCEEECCCCCCCHH | 42.92 | 24043423 | |
23 | Methylation | SYETTTDCPNLQPYF CEEECCCCCCCHHHH | 1.95 | 12876325 | |
29 | Phosphorylation | DCPNLQPYFSRCNSI CCCCCHHHHHHCCCE | 10.96 | 24043423 | |
31 | Phosphorylation | PNLQPYFSRCNSIRV CCCHHHHHHCCCEEE | 30.04 | 24043423 | |
63 | Phosphorylation | YLLRRGEYPDYQQWM HHHHCCCCCCHHHHH | 12.29 | 22817900 | |
66 | Phosphorylation | RRGEYPDYQQWMGLS HCCCCCCHHHHHCCC | 9.71 | 22817900 | |
80 | Methylation | SDSIRSCCLIPQTVS CHHHHHHCCCCHHHH | 3.99 | - | |
119 | Phosphorylation | IQDRFHLSEIRSLHV HHHHHCHHHHHHHHH | 23.54 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CRGC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CRGC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CRGC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CRYAA_HUMAN | CRYAA | physical | 11700327 | |
CRYAB_HUMAN | CRYAB | physical | 11700327 | |
CRBB2_HUMAN | CRYBB2 | physical | 11700327 | |
CRGC_HUMAN | CRYGC | physical | 11700327 | |
CRGC_HUMAN | CRYGC | physical | 12601044 | |
CRYAA_HUMAN | CRYAA | physical | 12601044 | |
CRYAB_HUMAN | CRYAB | physical | 12601044 | |
CRBB2_HUMAN | CRYBB2 | physical | 12601044 | |
CRGD_HUMAN | CRYGD | physical | 12601044 | |
HSPB1_HUMAN | HSPB1 | physical | 12601044 | |
HSPB2_HUMAN | HSPB2 | physical | 12601044 | |
CRGB_HUMAN | CRYGB | physical | 26186194 | |
CRGB_HUMAN | CRYGB | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
604307 | Cataract 2, multiple types (CTRCT2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Methylation | |
Reference | PubMed |
"Methylation and carbamylation of human gamma-crystallins."; Lapko V.N., Smith D.L., Smith J.B.; Protein Sci. 12:1762-1774(2003). Cited for: METHYLATION AT CYS-23, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Shotgun identification of protein modifications from proteincomplexes and lens tissue."; MacCoss M.J., McDonald W.H., Saraf A., Sadygov R., Clark J.M.,Tasto J.J., Gould K.L., Wolters D., Washburn M., Weiss A., Clark J.I.,Yates J.R. III; Proc. Natl. Acad. Sci. U.S.A. 99:7900-7905(2002). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-63 AND TYR-66,SUSCEPTIBILITY TO OXIDATION, AND MASS SPECTROMETRY. |