UniProt ID | HSPB2_HUMAN | |
---|---|---|
UniProt AC | Q16082 | |
Protein Name | Heat shock protein beta-2 | |
Gene Name | HSPB2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 182 | |
Subcellular Localization | Cytoplasm . Nucleus . Localizes to nuclear foci. | |
Protein Description | May regulate the kinase DMPK.. | |
Protein Sequence | MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGRSVPHA ------CCCCCCCCC | 42.80 | 24043423 | |
5 | Phosphorylation | ---MSGRSVPHAHPA ---CCCCCCCCCCCC | 43.45 | 24719451 | |
13 | Phosphorylation | VPHAHPATAEYEFAN CCCCCCCCCEEEECC | 25.19 | 24043423 | |
16 | Phosphorylation | AHPATAEYEFANPSR CCCCCCEEEECCHHH | 17.55 | 24043423 | |
22 | Phosphorylation | EYEFANPSRLGEQRF EEEECCHHHHCCCCC | 39.69 | 24719451 | |
44 | Phosphorylation | EILTPTLYHGYYVRP HHCCCCEECCEEECC | 8.83 | - | |
52 | Methylation | HGYYVRPRAAPAGEG CCEEECCCCCCCCCC | 32.58 | 24387967 | |
60 | Phosphorylation | AAPAGEGSRAGASEL CCCCCCCCCCCCCEE | 18.04 | 26437602 | |
61 | Methylation | APAGEGSRAGASELR CCCCCCCCCCCCEEE | 48.15 | 24387977 | |
65 | Phosphorylation | EGSRAGASELRLSEG CCCCCCCCEEECCCC | 35.92 | 29743597 | |
70 | Phosphorylation | GASELRLSEGKFQAF CCCEEECCCCCEEEE | 37.56 | 26437602 | |
92 | Phosphorylation | PDEVTVRTVDNLLEV CCCEEEEEHHHHHHH | 28.07 | 26437602 | |
100 | Phosphorylation | VDNLLEVSARHPQRL HHHHHHHHHHCCHHH | 15.37 | 26437602 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSPB2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSPB2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSPB2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...