BEX4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BEX4_HUMAN
• UniProt AC: Q9NWD9
• Protein Name: Protein BEX4 {ECO:0000305}
• Gene Name: BEX4 {ECO:0000303|PubMed:15958283, ECO:0000312|HGNC:HGNC:25475}
• Organism: Homo sapiens (Human).
• Sequence Length: 120
• Subcellular Localization: Cytoplasm, cytoskeleton, spindle pole . Nucleus . Cytoplasm . Also localizes to microtubules.
• Protein Description: May play a role in microtubule deacetylation by negatively regulating the SIRT2 deacetylase activity toward alpha-tubulin and thereby participate to the control of cell cycle progression and genomic stability..
• Protein Sequence: MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Ubiquitination	LGGGEGQKPGGNIRR CCCCCCCCCCCCCCC	57.39	32142685
91	Ubiquitination	VGQMMEIKRKTREQQ HHHHHHHHHHHHHHH	34.24	21890473
93	Ubiquitination	QMMEIKRKTREQQMR HHHHHHHHHHHHHHH	47.10	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BEX4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BEX4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BEX4_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of BEX4_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.