UniProt ID | SDF2_HUMAN | |
---|---|---|
UniProt AC | Q99470 | |
Protein Name | Stromal cell-derived factor 2 | |
Gene Name | SDF2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 211 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
87 | Ubiquitination | CERGTPIKCGQPIRL ECCCCCCCCCCCEEE | 33.25 | - | |
171 | Phosphorylation | EQYGRPISGQKEVHG HHHCCCCCCCCCCCC | 37.54 | - | |
174 | Ubiquitination | GRPISGQKEVHGMAQ CCCCCCCCCCCCCCC | 66.29 | - | |
199 | Phosphorylation | EGIFMKPSELLKAEA CEEECCHHHHHHHHH | 35.04 | - | |
203 | Ubiquitination | MKPSELLKAEAHHAE CCHHHHHHHHHHHCC | 57.73 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDF2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDF2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDF2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ALS2_HUMAN | ALS2 | physical | 28514442 | |
GRP78_HUMAN | HSPA5 | physical | 28514442 | |
DJB11_HUMAN | DNAJB11 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...