UniProt ID | LALBA_HUMAN | |
---|---|---|
UniProt AC | P00709 | |
Protein Name | Alpha-lactalbumin | |
Gene Name | LALBA | |
Organism | Homo sapiens (Human). | |
Sequence Length | 142 | |
Subcellular Localization | Secreted. | |
Protein Description | Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.. | |
Protein Sequence | MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | QFTKCELSQLLKDID HCCHHHHHHHHHHCC | 9.11 | 24719451 | |
37 | Nitration | LLKDIDGYGGIALPE HHHHCCCCCCCCHHH | 14.39 | - | |
64 | N-linked_Glycosylation | TQAIVENNESTEYGL CEEEECCCCCCCEEE | 30.96 | 18780401 | |
90 | N-linked_Glycosylation | SQVPQSRNICDISCD CCCCCCCCCCCCCCC | 44.48 | UniProtKB CARBOHYD | |
90 | N-linked_Glycosylation | SQVPQSRNICDISCD CCCCCCCCCCCCCCC | 44.48 | 9365923 | |
105 | Phosphorylation | KFLDDDITDDIMCAK CCCCCCCCHHHHHHH | 34.31 | - | |
122 | Nitration | LDIKGIDYWLAHKAL HCCCCCCHHHHHHHH | 10.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LALBA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LALBA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LALBA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSP7C_HUMAN | HSPA8 | physical | 20618441 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Identification of N-linked glycoproteins in human milk by hydrophilicinteraction liquid chromatography and mass spectrometry."; Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.; Proteomics 8:3833-3847(2008). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64, AND MASS SPECTROMETRY. |