| UniProt ID | LALBA_HUMAN | |
|---|---|---|
| UniProt AC | P00709 | |
| Protein Name | Alpha-lactalbumin | |
| Gene Name | LALBA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 142 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins.. | |
| Protein Sequence | MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Phosphorylation | QFTKCELSQLLKDID HCCHHHHHHHHHHCC | 9.11 | 24719451 | |
| 37 | Nitration | LLKDIDGYGGIALPE HHHHCCCCCCCCHHH | 14.39 | - | |
| 64 | N-linked_Glycosylation | TQAIVENNESTEYGL CEEEECCCCCCCEEE | 30.96 | 18780401 | |
| 90 | N-linked_Glycosylation | SQVPQSRNICDISCD CCCCCCCCCCCCCCC | 44.48 | UniProtKB CARBOHYD | |
| 90 | N-linked_Glycosylation | SQVPQSRNICDISCD CCCCCCCCCCCCCCC | 44.48 | 9365923 | |
| 105 | Phosphorylation | KFLDDDITDDIMCAK CCCCCCCCHHHHHHH | 34.31 | - | |
| 122 | Nitration | LDIKGIDYWLAHKAL HCCCCCCHHHHHHHH | 10.62 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LALBA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LALBA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LALBA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HSP7C_HUMAN | HSPA8 | physical | 20618441 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Identification of N-linked glycoproteins in human milk by hydrophilicinteraction liquid chromatography and mass spectrometry."; Picariello G., Ferranti P., Mamone G., Roepstorff P., Addeo F.; Proteomics 8:3833-3847(2008). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-64, AND MASS SPECTROMETRY. | |