| UniProt ID | B2LA1_HUMAN | |
|---|---|---|
| UniProt AC | Q16548 | |
| Protein Name | Bcl-2-related protein A1 | |
| Gene Name | BCL2A1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 175 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 (By similarity).. | |
| Protein Sequence | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | PQPGSGPSKTSRVLQ CCCCCCCCHHHHHHH | 52.68 | - | |
| 50 | Acetylation | SVQKEVEKNLKSCLD HHHHHHHHHHHHHHH | 73.15 | 7964221 | |
| 130 | Phosphorylation | AEFIMNNTGEWIRQN HHHHHHCCCHHHHHC | 31.32 | 25159151 | |
| 169 | Phosphorylation | GKICEMLSLLKQYC- HHHHHHHHHHHHHC- | 30.28 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B2LA1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B2LA1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B2LA1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BAD_HUMAN | BAD | physical | 11483855 | |
| BMF_HUMAN | BMF | physical | 15694340 | |
| BAD_HUMAN | BAD | physical | 15694340 | |
| APR_HUMAN | PMAIP1 | physical | 15694340 | |
| BIK_HUMAN | BIK | physical | 15694340 | |
| HRK_HUMAN | HRK | physical | 15694340 | |
| A4_HUMAN | APP | physical | 21832049 | |
| NR4A1_HUMAN | NR4A1 | physical | 18835031 | |
| BIK_HUMAN | BIK | physical | 25416956 | |
| FAM9B_HUMAN | FAM9B | physical | 25416956 | |
| BID_HUMAN | BID | physical | 16697956 | |
| B2L11_HUMAN | BCL2L11 | physical | 16697956 | |
| BBC3B_HUMAN | BBC3 | physical | 16697956 | |
| BBC3_HUMAN | BBC3 | physical | 16697956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
