| UniProt ID | BBC3B_HUMAN | |
|---|---|---|
| UniProt AC | Q96PG8 | |
| Protein Name | Bcl-2-binding component 3 | |
| Gene Name | BBC3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 261 | |
| Subcellular Localization | Mitochondrion . Localized to the mitochondria in order to induce cytochrome c release. Isoform 3 is not found in mitochondria. | |
| Protein Description | Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis. Isoform 3 fails to show any growth-inhibitory or apoptotic activity.. | |
| Protein Sequence | MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 69 | Phosphorylation | RPPGALGSVLRPLRA CCCCHHHHHHHHHHC | 20.87 | 27174698 | |
| 160 | Phosphorylation | SHPGGPGSPRGGGTV CCCCCCCCCCCCCCC | 17.98 | 29954749 | |
| 162 | Methylation | PGGPGSPRGGGTVGP CCCCCCCCCCCCCCC | 59.07 | - | |
| 185 | Phosphorylation | DGGRPQRTVRAAETR CCCCCHHHHCHHHHC | 14.75 | 24719451 | |
| 191 | Phosphorylation | RTVRAAETRGAAAAP HHHCHHHHCCCCCCC | 29.67 | 24719451 | |
| 208 | Phosphorylation | TLEGPVQSHHGTPAL EEECCCCCCCCCCCC | 20.06 | 28348404 | |
| 216 | Phosphorylation | HHGTPALTQGPQSPR CCCCCCCCCCCCCCC | 33.32 | 27050516 | |
| 221 | Phosphorylation | ALTQGPQSPRDGAQL CCCCCCCCCCCCCCC | 25.65 | 28348404 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BBC3B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BBC3B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BBC3B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BCL2_HUMAN | BCL2 | physical | 15694340 | |
| B2CL1_HUMAN | BCL2L1 | physical | 15694340 | |
| MCL1_HUMAN | MCL1 | physical | 15694340 | |
| BCL2_HUMAN | BCL2 | physical | 11463392 | |
| MCL1_HUMAN | MCL1 | physical | 21730980 | |
| B2CL1_HUMAN | BCL2L1 | physical | 19074266 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
