APR_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APR_HUMAN
• UniProt AC: Q13794
• Protein Name: Phorbol-12-myristate-13-acetate-induced protein 1
• Gene Name: PMAIP1
• Organism: Homo sapiens (Human).
• Sequence Length: 54
• Subcellular Localization: Mitochondrion .
• Protein Description: Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1..
• Protein Sequence: MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	ARKNAQPSPARAPAE HHCCCCCCCCCCCHH	21.07	30576142
35	Ubiquitination	QLRRFGDKLNFRQKL HHHHHHHHHHHHHHH	45.79	21906983
41	Ubiquitination	DKLNFRQKLLNLISK HHHHHHHHHHHHHHH	51.16	21906983
47	Phosphorylation	QKLLNLISKLFCSGT HHHHHHHHHHHHCCC	26.86	27461979
48	Ubiquitination	KLLNLISKLFCSGT- HHHHHHHHHHHCCC-	38.29	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
13	S	Phosphorylation	Kinase	CDK5	Q00535	PSP
-	K	Ubiquitination	E3 ubiquitin ligase	SAG	P10523	PMID:23136067

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APR_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APR_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BAX_HUMAN	BAX	physical	15705586
MCL1_HUMAN	MCL1	physical	15694340
MCL1_HUMAN	MCL1	physical	15901672
ZBT16_HUMAN	ZBTB16	physical	16169070
B2CL1_HUMAN	BCL2L1	physical	10807576
BCL2_HUMAN	BCL2	physical	10807576
MCL1_HUMAN	MCL1	physical	22361683
UCHL1_HUMAN	UCHL1	physical	23499448
MCL1_HUMAN	MCL1	physical	27517746

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.