| UniProt ID | APR_HUMAN | |
|---|---|---|
| UniProt AC | Q13794 | |
| Protein Name | Phorbol-12-myristate-13-acetate-induced protein 1 | |
| Gene Name | PMAIP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 54 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.. | |
| Protein Sequence | MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Phosphorylation | ARKNAQPSPARAPAE HHCCCCCCCCCCCHH | 21.07 | 30576142 | |
| 35 | Ubiquitination | QLRRFGDKLNFRQKL HHHHHHHHHHHHHHH | 45.79 | 21906983 | |
| 41 | Ubiquitination | DKLNFRQKLLNLISK HHHHHHHHHHHHHHH | 51.16 | 21906983 | |
| 47 | Phosphorylation | QKLLNLISKLFCSGT HHHHHHHHHHHHCCC | 26.86 | 27461979 | |
| 48 | Ubiquitination | KLLNLISKLFCSGT- HHHHHHHHHHHCCC- | 38.29 | 21906983 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of APR_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of APR_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BAX_HUMAN | BAX | physical | 15705586 | |
| MCL1_HUMAN | MCL1 | physical | 15694340 | |
| MCL1_HUMAN | MCL1 | physical | 15901672 | |
| ZBT16_HUMAN | ZBTB16 | physical | 16169070 | |
| B2CL1_HUMAN | BCL2L1 | physical | 10807576 | |
| BCL2_HUMAN | BCL2 | physical | 10807576 | |
| MCL1_HUMAN | MCL1 | physical | 22361683 | |
| UCHL1_HUMAN | UCHL1 | physical | 23499448 | |
| MCL1_HUMAN | MCL1 | physical | 27517746 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...