UniProt ID | BMF_HUMAN | |
---|---|---|
UniProt AC | Q96LC9 | |
Protein Name | Bcl-2-modifying factor | |
Gene Name | BMF | |
Organism | Homo sapiens (Human). | |
Sequence Length | 184 | |
Subcellular Localization | ||
Protein Description | May play a role in apoptosis. Isoform 1 seems to be the main initiator.. | |
Protein Sequence | MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
53 | Phosphorylation | RLQLFPLTHCCGPGL HCCCCCCCCCCCCCC | 17.07 | 28450419 | |
63 | Phosphorylation | CGPGLRPTSQEDKAT CCCCCCCCCHHHHHC | 36.29 | 28450419 | |
64 | Phosphorylation | GPGLRPTSQEDKATQ CCCCCCCCHHHHHCC | 33.97 | 28450419 | |
70 | Phosphorylation | TSQEDKATQTLSPAS CCHHHHHCCCCCCCC | 28.03 | 30108239 | |
72 | Phosphorylation | QEDKATQTLSPASPS HHHHHCCCCCCCCCC | 25.50 | 30108239 | |
74 | Phosphorylation | DKATQTLSPASPSQG HHHCCCCCCCCCCCC | 23.08 | 28450419 | |
77 | Phosphorylation | TQTLSPASPSQGVML CCCCCCCCCCCCEEE | 28.59 | 28450419 | |
79 | Phosphorylation | TLSPASPSQGVMLPC CCCCCCCCCCEEECC | 36.75 | 30108239 | |
89 | Phosphorylation | VMLPCGVTEEPQRLF EEECCCCCCCCCEEE | 21.66 | 24043423 | |
97 | Phosphorylation | EEPQRLFYGNAGYRL CCCCEEECCCCCCCC | 17.67 | 27642862 | |
109 | Phosphorylation | YRLPLPASFPAVLPI CCCCCCCCCCEEEEC | 29.80 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BMF_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BMF_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BCL2_HUMAN | BCL2 | physical | 11546872 | |
B2CL2_HUMAN | BCL2L2 | physical | 11546872 | |
MYO5A_HUMAN | MYO5A | physical | 11546872 | |
CXCL9_HUMAN | CXCL9 | physical | 21988832 | |
NNMT_HUMAN | NNMT | physical | 21988832 | |
HTF4_HUMAN | TCF12 | physical | 21988832 | |
DYL2_HUMAN | DYNLL2 | physical | 25416956 | |
S14L4_HUMAN | SEC14L4 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...