BMF_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BMF_HUMAN
• UniProt AC: Q96LC9
• Protein Name: Bcl-2-modifying factor
• Gene Name: BMF
• Organism: Homo sapiens (Human).
• Sequence Length: 184
• Protein Description: May play a role in apoptosis. Isoform 1 seems to be the main initiator..
• Protein Sequence: MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Phosphorylation	RLQLFPLTHCCGPGL HCCCCCCCCCCCCCC	17.07	28450419
63	Phosphorylation	CGPGLRPTSQEDKAT CCCCCCCCCHHHHHC	36.29	28450419
64	Phosphorylation	GPGLRPTSQEDKATQ CCCCCCCCHHHHHCC	33.97	28450419
70	Phosphorylation	TSQEDKATQTLSPAS CCHHHHHCCCCCCCC	28.03	30108239
72	Phosphorylation	QEDKATQTLSPASPS HHHHHCCCCCCCCCC	25.50	30108239
74	Phosphorylation	DKATQTLSPASPSQG HHHCCCCCCCCCCCC	23.08	28450419
77	Phosphorylation	TQTLSPASPSQGVML CCCCCCCCCCCCEEE	28.59	28450419
79	Phosphorylation	TLSPASPSQGVMLPC CCCCCCCCCCEEECC	36.75	30108239
89	Phosphorylation	VMLPCGVTEEPQRLF EEECCCCCCCCCEEE	21.66	24043423
97	Phosphorylation	EEPQRLFYGNAGYRL CCCCEEECCCCCCCC	17.67	27642862
109	Phosphorylation	YRLPLPASFPAVLPI CCCCCCCCCCEEEEC	29.80	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
74	S	Phosphorylation	Kinase	MAPK1	P28482	GPS
74	S	Phosphorylation	Kinase	MAPK8	P45983	GPS
77	S	Phosphorylation	Kinase	MAPK1	P28482	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BMF_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BMF_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BCL2_HUMAN	BCL2	physical	11546872
B2CL2_HUMAN	BCL2L2	physical	11546872
MYO5A_HUMAN	MYO5A	physical	11546872
CXCL9_HUMAN	CXCL9	physical	21988832
NNMT_HUMAN	NNMT	physical	21988832
HTF4_HUMAN	TCF12	physical	21988832
DYL2_HUMAN	DYNLL2	physical	25416956
S14L4_HUMAN	SEC14L4	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.