UniProt ID | B2CL2_HUMAN | |
---|---|---|
UniProt AC | Q92843 | |
Protein Name | Bcl-2-like protein 2 | |
Gene Name | BCL2L2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 193 | |
Subcellular Localization |
Mitochondrion membrane Peripheral membrane protein . Loosely associated with the mitochondrial membrane in healthy cells. During apoptosis, tightly bound to the membrane. |
|
Protein Description | Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.. | |
Protein Sequence | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATPASAPD ------CCCCCCCCC | 23.45 | 19413330 | |
20 | Phosphorylation | LVADFVGYKLRQKGY HHHHHHCHHHHHCCC | 11.10 | 26437602 | |
60 | Phosphorylation | FETRFRRTFSDLAAQ HHHHHHHHHHHHHHH | 24.20 | 28857561 | |
62 | Phosphorylation | TRFRRTFSDLAAQLH HHHHHHHHHHHHHHC | 30.97 | 26657352 | |
162 (in isoform 2) | Ubiquitination | - | 4.94 | - | |
164 (in isoform 2) | Ubiquitination | - | 62.56 | - | |
172 | Phosphorylation | GNWASVRTVLTGAVA CCCHHHHHHHHHHHH | 20.08 | 22817900 | |
175 | Phosphorylation | ASVRTVLTGAVALGA HHHHHHHHHHHHHHH | 20.82 | 22817900 | |
177 (in isoform 2) | Phosphorylation | - | 4.34 | 20068231 | |
192 | Phosphorylation | TVGAFFASK------ HHHHHHCCC------ | 33.47 | 18187866 | |
193 | Ubiquitination | VGAFFASK------- HHHHHCCC------- | 62.01 | - | |
224 (in isoform 2) | Phosphorylation | - | - | ||
234 (in isoform 2) | Acetylation | - | - | ||
234 (in isoform 2) | Ubiquitination | - | - | ||
244 (in isoform 2) | Phosphorylation | - | - | ||
254 (in isoform 2) | Methylation | - | - | ||
262 (in isoform 2) | Phosphorylation | - | 24275569 | ||
265 (in isoform 2) | Methylation | - | - | ||
267 (in isoform 2) | Methylation | - | - | ||
286 (in isoform 2) | Methylation | - | 24129315 | ||
290 (in isoform 2) | Methylation | - | 24129315 | ||
294 (in isoform 2) | Dimethylation | - | - | ||
304 (in isoform 2) | Methylation | - | - | ||
314 (in isoform 2) | Methylation | - | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of B2CL2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of B2CL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of B2CL2_HUMAN !! |
loading...
Phosphorylation | |
Reference | PubMed |
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-192, AND MASSSPECTROMETRY. |