UniProt ID | BAK_HUMAN | |
---|---|---|
UniProt AC | Q16611 | |
Protein Name | Bcl-2 homologous antagonist/killer | |
Gene Name | BAK1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 211 | |
Subcellular Localization |
Mitochondrion membrane Single-pass membrane protein . |
|
Protein Description | Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.. | |
Protein Sequence | MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASGQGPGP ------CCCCCCCCC | 23.51 | 19413330 | |
3 | Phosphorylation | -----MASGQGPGPP -----CCCCCCCCCC | 30.28 | 28961369 | |
108 | Phosphorylation | QPTAENAYEYFTKIA CCCHHHHHHHHHHHH | 23.81 | 22817900 | |
110 | Phosphorylation | TAENAYEYFTKIATS CHHHHHHHHHHHHHH | 12.13 | 22817900 | |
117 | Phosphorylation | YFTKIATSLFESGIN HHHHHHHHHHHCCCC | 23.26 | - | |
148 | Phosphorylation | HVYQHGLTGFLGQVT HHHHHCHHHHHHHHH | 30.40 | 21406692 | |
155 | Phosphorylation | TGFLGQVTRFVVDFM HHHHHHHHHHHHHHH | 15.53 | 21406692 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BAK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BAK_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...