dbPTM

S14L4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	S14L4_HUMAN
UniProt AC	Q9UDX3
Protein Name	SEC14-like protein 4
Gene Name	SEC14L4
Organism	Homo sapiens (Human).
Sequence Length	406
Subcellular Localization
Protein Description	Probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids..
Protein Sequence	MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSPTQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	SSRVGDLSPQQQEAL CCCCCCCCHHHHHHH	25.96	30576742
114	Phosphorylation	DPKGLLLSASKQDMI CHHHEEECCCHHHHH	30.39	23312004
159	Phosphorylation	VFDMEGLSLKHLWKP HHCCCCCCHHHHHHH	46.35	24719451
278	Phosphorylation	CEQVRLQYEHTRSVG ECEEEEEEECCCCCC	17.80	29759185
281	Phosphorylation	VRLQYEHTRSVGRGS EEEEEECCCCCCCCC	16.82	29759185
286	Methylation	EHTRSVGRGSSLQVE ECCCCCCCCCCCEEE	39.40	-
339	Phosphorylation	EMTEVLPSQRYNAHM HHHHHCCHHCCCCEE	24.11	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of S14L4_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of S14L4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of S14L4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
INCA1_HUMAN	INCA1	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of S14L4_HUMAN

Related Literatures of Post-Translational Modification